DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lint-1 and phf-33

DIOPT Version :10

Sequence 1:NP_572692.1 Gene:Lint-1 / 32055 FlyBaseID:FBgn0030274 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_001359533.1 Gene:phf-33 / 187186 WormBaseID:WBGene00010708 Length:686 Species:Caenorhabditis elegans


Alignment Length:79 Identity:23/79 - (29%)
Similarity:37/79 - (46%) Gaps:6/79 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 SKRTYTRKSKSPDEISEKSSAGGGSGASGTASSSACQHK--DGGASKCRKCRECRECKRRVETEA 559
            :||. |.|..:|.:|.|:.: .......|..|||:..|:  |......::.:.|..|.||  .|.
 Worm     2 TKRN-TNKKLAPKKIKEELT-DMTPKMRGECSSSSQDHESDDDAEWDYKEQKACCICARR--GEV 62

  Fly   560 MYCHLCSGLYHMDC 573
            ::||.|...:|:.|
 Worm    63 LWCHSCPASFHIKC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lint-1NP_572692.1 PHD 548..593 CDD:214584 10/26 (38%)
phf-33NP_001359533.1 PHD 53..95 CDD:214584 10/26 (38%)
FHA 578..683 CDD:438714
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.