DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15202 and CG14132

DIOPT Version :9

Sequence 1:NP_001245618.1 Gene:CG15202 / 32052 FlyBaseID:FBgn0030271 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_001097586.1 Gene:CG14132 / 50290 FlyBaseID:FBgn0040817 Length:118 Species:Drosophila melanogaster


Alignment Length:115 Identity:32/115 - (27%)
Similarity:51/115 - (44%) Gaps:27/115 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AGVACLLVLLGICGAARADLTYRGNAV-HPDYPGQCYYEELNQAIPKKQSYKPINREGYCQSIYC 66
            |.:|.:.:...:..||    .|...|: ||.:||:|:.:...:|:...:.|||   :|.|.::.|
  Fly     8 AAIALIAIFASVVDAA----IYSQPAIFHPAHPGKCFDKLTRKALLPDKEYKP---KGICAAMTC 65

  Fly    67 RPDYVLEISYCGRHNLVPTEKC---------RIASDMRRTFPECCPKLVC 107
            ..: .||||         .|.|         .:.||....||:|||:..|
  Fly    66 SLE-ALEIS---------IETCPYVEAPGCEELPSDPNWRFPKCCPQFKC 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15202NP_001245618.1 SVWC 37..107 CDD:292070 21/78 (27%)
CG14132NP_001097586.1 SVWC 48..105 CDD:292070 19/69 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469176
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D128223at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.