DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15202 and Vago

DIOPT Version :9

Sequence 1:NP_001245618.1 Gene:CG15202 / 32052 FlyBaseID:FBgn0030271 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_001285106.1 Gene:Vago / 32040 FlyBaseID:FBgn0030262 Length:160 Species:Drosophila melanogaster


Alignment Length:93 Identity:23/93 - (24%)
Similarity:40/93 - (43%) Gaps:23/93 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NQAIPKKQSYKPINREGYC-QSIYCRPDYVLEI----SYCGRHNLVPT-----EKCRI------- 90
            :||||.:.|....|:: || .::..|..|:.|:    ..|.|...:.|     :.|::       
  Fly    21 SQAIPYRPSAYLYNQQ-YCMDTLTGRQLYIGEVFTREDQCVRIQCLETLQLWEDSCQVPKLTQGN 84

  Fly    91 -----ASDMRRTFPECCPKLVCQESESN 113
                 :::....:|.|||...|:..|||
  Fly    85 CTPVPSTNPHAEYPRCCPLYECKSYESN 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15202NP_001245618.1 SVWC 37..107 CDD:292070 19/85 (22%)
VagoNP_001285106.1 SVWC 41..106 CDD:292070 11/64 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469178
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.