DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15199 and CG14132

DIOPT Version :9

Sequence 1:NP_001245617.1 Gene:CG15199 / 32051 FlyBaseID:FBgn0030270 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001097586.1 Gene:CG14132 / 50290 FlyBaseID:FBgn0040817 Length:118 Species:Drosophila melanogaster


Alignment Length:112 Identity:33/112 - (29%)
Similarity:56/112 - (50%) Gaps:18/112 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLAFVACLLAASVDGNGFSTQYRGHTQHPSLAEHCLYEELDLAVPLNGYVLPSGQ---QGYCIRL 69
            ::|.:| :.|:.||...:|.....|..||.   .| :::|....     :||..:   :|.|..:
  Fly     9 AIALIA-IFASVVDAAIYSQPAIFHPAHPG---KC-FDKLTRKA-----LLPDKEYKPKGICAAM 63

  Fly    70 ECTDDYL-LLIRHCDKQPW-PRPGCHLSPNDYDFKFPECCPQLECSD 114
            .|:.:.| :.|..|   |: ..|||...|:|.:::||:||||.:|.|
  Fly    64 TCSLEALEISIETC---PYVEAPGCEELPSDPNWRFPKCCPQFKCVD 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15199NP_001245617.1 SVWC 53..112 CDD:292070 20/63 (32%)
CG14132NP_001097586.1 SVWC 48..105 CDD:292070 20/59 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D128223at33392
OrthoFinder 1 1.000 - - FOG0012726
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.