DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15199 and CG15202

DIOPT Version :9

Sequence 1:NP_001245617.1 Gene:CG15199 / 32051 FlyBaseID:FBgn0030270 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001245618.1 Gene:CG15202 / 32052 FlyBaseID:FBgn0030271 Length:115 Species:Drosophila melanogaster


Alignment Length:113 Identity:42/113 - (37%)
Similarity:56/113 - (49%) Gaps:14/113 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AFVACLL-------AASVDGNGFSTQYRGHTQHPSLAEHCLYEELDLAVPLNGYVLPSGQQGYCI 67
            |.|||||       ||..|     ..|||:..||.....|.||||:.|:|......|..::|||.
  Fly     3 AGVACLLVLLGICGAARAD-----LTYRGNAVHPDYPGQCYYEELNQAIPKKQSYKPINREGYCQ 62

  Fly    68 RLECTDDYLLLIRHCDKQPW-PRPGCHLSPNDYDFKFPECCPQLECSD 114
            .:.|..||:|.|.:|.:... |...|.:: :|....||||||:|.|.:
  Fly    63 SIYCRPDYVLEISYCGRHNLVPTEKCRIA-SDMRRTFPECCPKLVCQE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15199NP_001245617.1 SVWC 53..112 CDD:292070 20/59 (34%)
CG15202NP_001245618.1 SVWC 37..107 CDD:292070 27/70 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469174
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I7682
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D128223at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.