DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK2AP1 and CDK2AP1

DIOPT Version :9

Sequence 1:NP_001259439.1 Gene:CDK2AP1 / 32050 FlyBaseID:FBgn0030269 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_004633.1 Gene:CDK2AP1 / 8099 HGNCID:14002 Length:115 Species:Homo sapiens


Alignment Length:141 Identity:62/141 - (43%)
Similarity:76/141 - (53%) Gaps:35/141 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 AAVAAAALSLANMCSSNGGQRNSGAGVSSTSSGSNGQSMGLNLSSSQLKYPPPSTSPVVVTTQTS 204
            |.:.||||:.|....|           .|||..::.|...| ||.    |.|||..    .||.:
Human     9 AHMPAAALNAAGSVHS-----------PSTSMATSSQYRQL-LSD----YGPPSLG----YTQGT 53

  Fly   205 ANITTPLTSTASLPSVGPGNGLTKYAQLLAVIEEMGRDIRPTYTGSRSSTERLKRGIVHARILVR 269
            .|...|               .:|||:|||:|||:|::|||||.||:|:.|||||||:|||.|||
Human    54 GNSQVP---------------QSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVR 103

  Fly   270 ECLMETERAAR 280
            |||.||||.||
Human   104 ECLAETERNAR 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK2AP1NP_001259439.1 CDK2AP 1..280 CDD:286844 60/139 (43%)
CDK2AP1NP_004633.1 Interaction with CDK2AP2. /evidence=ECO:0000269|PubMed:14985111 20..25 0/4 (0%)
CDK2AP <62..114 CDD:370710 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148263
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4713
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003406
OrthoInspector 1 1.000 - - otm41789
orthoMCL 1 0.900 - - OOG6_109195
Panther 1 1.100 - - LDO PTHR22607
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4094
SonicParanoid 1 1.000 - - X2302
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.730

Return to query results.
Submit another query.