DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK2AP1 and Cdk2ap2

DIOPT Version :9

Sequence 1:NP_001259439.1 Gene:CDK2AP1 / 32050 FlyBaseID:FBgn0030269 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_080649.1 Gene:Cdk2ap2 / 52004 MGIID:1098779 Length:127 Species:Mus musculus


Alignment Length:136 Identity:58/136 - (42%)
Similarity:71/136 - (52%) Gaps:29/136 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 SSNGGQRNSGAGVSSTSSGSNGQSMGLNLSSSQLKYPPPSTSPVVVTTQTSANITTPLTSTASLP 218
            ||..|....|.|....::||               .|.||.|     ...:|....||.:....|
Mouse    11 SSTPGSSTPGPGTPVPTAGS---------------VPSPSGS-----VPGAAAPFRPLFNDFGPP 55

  Fly   219 SVG-------PGN--GLTKYAQLLAVIEEMGRDIRPTYTGSRSSTERLKRGIVHARILVRECLME 274
            |:|       ||:  ..:.|..||:||||||::|||||.||:|:.|||||||:|||.||||||.|
Mouse    56 SMGYVQAMKPPGSQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAE 120

  Fly   275 TERAAR 280
            |||.||
Mouse   121 TERNAR 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK2AP1NP_001259439.1 CDK2AP 1..280 CDD:286844 56/134 (42%)
Cdk2ap2NP_080649.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47 12/55 (22%)
rad23 <5..>107 CDD:273167 41/115 (36%)
CDK2AP <63..126 CDD:370710 39/62 (63%)
Interaction with CDK2. /evidence=ECO:0000250|UniProtKB:O75956 65..107 24/41 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838353
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4713
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003406
OrthoInspector 1 1.000 - - otm43841
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22607
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4094
SonicParanoid 1 1.000 - - X2302
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.