DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK2AP1 and Cdk2ap1

DIOPT Version :9

Sequence 1:NP_001259439.1 Gene:CDK2AP1 / 32050 FlyBaseID:FBgn0030269 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_038945523.1 Gene:Cdk2ap1 / 360804 RGDID:1308664 Length:180 Species:Rattus norvegicus


Alignment Length:68 Identity:45/68 - (66%)
Similarity:55/68 - (80%) Gaps:5/68 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 PSV--GPGNG---LTKYAQLLAVIEEMGRDIRPTYTGSRSSTERLKRGIVHARILVRECLMETER 277
            ||:  |.||.   .:|||:|||:|||:|::|||||.||:|:.|||||||:|||.||||||.||||
  Rat   112 PSMIWGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARSLVRECLAETER 176

  Fly   278 AAR 280
            .||
  Rat   177 NAR 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK2AP1NP_001259439.1 CDK2AP 1..280 CDD:286844 43/66 (65%)
Cdk2ap1XP_038945523.1 CDK2AP <127..179 CDD:370710 38/51 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342142
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4713
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003406
OrthoInspector 1 1.000 - - otm45927
orthoMCL 1 0.900 - - OOG6_109195
Panther 1 1.100 - - LDO PTHR22607
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2302
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.700

Return to query results.
Submit another query.