DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK2AP1 and Y43F4B.10

DIOPT Version :9

Sequence 1:NP_001259439.1 Gene:CDK2AP1 / 32050 FlyBaseID:FBgn0030269 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_741280.1 Gene:Y43F4B.10 / 176752 WormBaseID:WBGene00012807 Length:108 Species:Caenorhabditis elegans


Alignment Length:88 Identity:33/88 - (37%)
Similarity:52/88 - (59%) Gaps:4/88 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 TSTASLPSVGPGNGLTKYAQLLAVIEEMGRDIRPTYTGSRSSTERLKRGIVHARILVRECLMETE 276
            |..:.:|::....|...|..||.:|||:|:|:|||||.::.:.|||||.|..|::|:|.|..|.|
 Worm     9 TLISIVPNLQMQEGTPYYEVLLKLIEEIGKDVRPTYTFNKLTCERLKRNIQAAKVLIRACQQEAE 73

  Fly   277 ----RAARQXEEESLAPQLATPE 295
                :|... |.:.:|.:..||:
 Worm    74 TDKKKADAAIEAQRVAQKSETPK 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK2AP1NP_001259439.1 CDK2AP 1..280 CDD:286844 29/71 (41%)
Y43F4B.10NP_741280.1 CDK2AP <26..75 CDD:286844 25/48 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157876
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4713
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003406
OrthoInspector 1 1.000 - - oto17285
orthoMCL 1 0.900 - - OOG6_109195
Panther 1 1.100 - - LDO PTHR22607
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4094
SonicParanoid 1 1.000 - - X2302
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.