DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK2AP1 and CDK2AP2

DIOPT Version :9

Sequence 1:NP_001259439.1 Gene:CDK2AP1 / 32050 FlyBaseID:FBgn0030269 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_005842.1 Gene:CDK2AP2 / 10263 HGNCID:30833 Length:126 Species:Homo sapiens


Alignment Length:118 Identity:52/118 - (44%)
Similarity:64/118 - (54%) Gaps:27/118 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PPPSTSPVVVTTQTSANITT------------------PLTSTASLPSVG-------PG--NGLT 227
            |.||::|...|......:.|                  ||.:....||:|       ||  ...:
Human     8 PAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQS 72

  Fly   228 KYAQLLAVIEEMGRDIRPTYTGSRSSTERLKRGIVHARILVRECLMETERAAR 280
            .|..||:||||||::|||||.||:|:.|||||||:|||.||||||.||||.||
Human    73 TYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNAR 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK2AP1NP_001259439.1 CDK2AP 1..280 CDD:286844 50/116 (43%)
CDK2AP2NP_005842.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48 7/39 (18%)
rad23 <5..>106 CDD:273167 35/97 (36%)
Interaction with CDK2. /evidence=ECO:0000269|PubMed:23781148 64..106 24/41 (59%)
CDK2AP <73..125 CDD:370710 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148264
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4713
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003406
OrthoInspector 1 1.000 - - otm41789
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22607
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4094
SonicParanoid 1 1.000 - - X2302
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.