DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK2AP1 and MPHOSPH9

DIOPT Version :9

Sequence 1:NP_001259439.1 Gene:CDK2AP1 / 32050 FlyBaseID:FBgn0030269 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_073619.3 Gene:MPHOSPH9 / 10198 HGNCID:7215 Length:1183 Species:Homo sapiens


Alignment Length:284 Identity:58/284 - (20%)
Similarity:91/284 - (32%) Gaps:110/284 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SQVQNFYNYQQQREQREQQPQIQISAIHHSRGSVGGGGGSNSSNAATDYSTSSGGKRERDRSSAS 88
            :|.:.|:| |.|..|.|.:..:::.....|..|..|    ||||           |:....|...
Human   106 AQQEQFHN-QIQHIQEEIKNLVKLQTSSASLASCEG----NSSN-----------KQVSSESQMG 154

  Fly    89 DYSSSSSKQSSAAAANAAAAAAAVAALQYSPQFLQAQLALLQQQSNTTATPAAVAAAALSLANMC 153
            .:|.||.:..|              .:.| |:..:.::    ||..:|:.|.            |
Human   155 FFSLSSERNES--------------VIHY-PESTEPEI----QQEMSTSQPD------------C 188

  Fly   154 SSNGGQRNSGAGVSSTSSGSNGQSMGLNLSSSQ--------LKYPP--------PSTSPVVVTTQ 202
            :.:....:||.|....|.        |||..|:        :..|.        |:.|.|.....
Human   189 NVDSCSVSSGYGTFCISE--------LNLYKSKDPKEFMEHIDVPKGQYVAPAVPAESLVDGVKN 245

  Fly   203 TSANITTPLTSTASLP---SVGPG----------------------NGLTKYAQLL-------AV 235
            .:..|.||.....||.   |:.||                      |.:|.:||.|       |.
Human   246 ENFYIQTPEECHVSLKEDVSISPGEFEHNFLGENKVSEVYSGKTNSNAITSWAQKLKQNQPKRAH 310

  Fly   236 IEEMGRDIRPTYTGSRSSTERLKR 259
            :|:.|       :.|:...|:.|:
Human   311 VEDGG-------SRSKQGNEQSKK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK2AP1NP_001259439.1 CDK2AP 1..280 CDD:286844 58/284 (20%)
MPHOSPH9NP_073619.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..52
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..334 7/35 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 472..495
Rootletin 621..795 CDD:291694
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 863..894
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 910..999
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4713
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.