DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp10A and cana

DIOPT Version :9

Sequence 1:NP_001285109.1 Gene:Klp10A / 32049 FlyBaseID:FBgn0030268 Length:805 Species:Drosophila melanogaster
Sequence 2:NP_001027247.1 Gene:cana / 3771934 FlyBaseID:FBgn0040233 Length:1931 Species:Drosophila melanogaster


Alignment Length:352 Identity:104/352 - (29%)
Similarity:175/352 - (49%) Gaps:54/352 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 ITVCVRKRPISRKEVNRKEIDVISVPRKDMLIVHEPRSKVDLTKFLENH--KFRFDYAFNDTCDN 341
            |.||::.||.        |..:.|:.:     |.|.||    .:..::|  .:.|||.|::...|
  Fly     9 IQVCIKVRPC--------EPGLTSLWQ-----VKEGRS----IQLADSHAEPYVFDYVFDEGASN 56

  Fly   342 AMVYKYTAKPLVKTIFEGGMATCFAYGQTGSGKTHTMGGEFNGKVQDCKNGIYAMAAKDVFVTLN 406
            ..|:...||.:|....:|...|.||||||.||||:||.|:      :...|:..:|||::|..::
  Fly    57 QEVFDRMAKHIVHACMQGSNGTIFAYGQTSSGKTYTMMGD------EQNPGVMVLAAKEIFQQIS 115

  Fly   407 MPRYRAMNLVVSASFFEIYSGKVFDLLSDK-QKLRVLEDGKQQVQVVGLTEKVVDGVEEVLKLIQ 470
            ....|  :.::...:.|||:.|::|||:.| |.|::.|.|...|. |...|.:|...:::|:.:.
  Fly   116 SETER--DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGIVN-VNCKESIVTSEDDLLRQLY 177

  Fly   471 HGNAARTSGQTSANSNSSRSHAVFQIVLRPQGS------TKIHGKFSFIDLAGNERGVDTSSADR 529
            .||..|..|:|:.|..||||||:|:|::..:.|      |......|.:||||:|          
  Fly   178 MGNKERVVGETNMNERSSRSHAIFRIIIESRKSDHSDNDTVKQSVLSLVDLAGSE---------- 232

  Fly   530 QTRMEGAEINKSLLALKECIRALGKQSAHLP--FRVSKLTQVLRDSFIGEKSKTCMIAMISPGLS 592
              :::.|:...||:..:..:::|.:.....|  ||.|||.:::..| :|....|.:|..|:|  |
  Fly   233 --QVDPADHASSLMIFRNLVKSLSESVDSKPNSFRDSKLPRIMLPS-LGGNVLTSIICTITP--S 292

  Fly   593 SCEHTLNTLRYADRVKELVVKDIVEVC 619
            ..|.:.:|:.:....|::..|.  :||
  Fly   293 FVEESSSTISFGTCAKKIRCKP--QVC 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp10ANP_001285109.1 KISc_KIF2_like 278..608 CDD:276818 100/339 (29%)
Kinesin 284..609 CDD:278646 97/335 (29%)
canaNP_001027247.1 KISc 8..316 CDD:214526 102/349 (29%)
Motor_domain 8..310 CDD:277568 101/341 (30%)
SMC_prok_B <471..1270 CDD:274008
Mplasa_alph_rch 924..1647 CDD:275316
CENP-H 1204..>1266 CDD:283493
CALCOCO1 <1489..1850 CDD:285171
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437838
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.