DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp10A and CG32318

DIOPT Version :9

Sequence 1:NP_001285109.1 Gene:Klp10A / 32049 FlyBaseID:FBgn0030268 Length:805 Species:Drosophila melanogaster
Sequence 2:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster


Alignment Length:170 Identity:45/170 - (26%)
Similarity:66/170 - (38%) Gaps:43/170 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 QAVDDHQITVCVRKRPISRKEVNRKEIDVISV--PRKDMLIVHEPRSKVDLTKFLENHKFRFDYA 334
            |...:..|.|.||.||::.:|...:..:|:.|  || :::..|...||  |||     ||.||.:
  Fly    13 QKKSNQNIQVYVRVRPLNSRERCIRSAEVVDVVGPR-EVVTRHTLDSK--LTK-----KFTFDRS 69

  Fly   335 FNDTCDNAMVYKYTAKPLVKTIFEGGMATCFAYGQTGSGKTHTMGGEFNGKVQDCKNGIYAMAAK 399
            |........||.....||::.:..|...|.|||||||:                           
  Fly    70 FGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGN--------------------------- 107

  Fly   400 DVFVTLNMPR--YRAMNLVVSASFFEIYSGKVFDLLSDKQ 437
                .|..|:  |..:..:.....||:..|:|..|..:.|
  Fly   108 ----NLRPPKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQ 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp10ANP_001285109.1 KISc_KIF2_like 278..608 CDD:276818 44/164 (27%)
Kinesin 284..609 CDD:278646 41/158 (26%)
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 33/96 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.