DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt3 and RPT6A

DIOPT Version :9

Sequence 1:NP_001285108.1 Gene:Rpt3 / 32047 FlyBaseID:FBgn0028686 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001318606.1 Gene:RPT6A / 832121 AraportID:AT5G19990 Length:419 Species:Arabidopsis thaliana


Alignment Length:370 Identity:167/370 - (45%)
Similarity:242/370 - (65%) Gaps:10/370 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 QKT--LEFIEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIVGSTTGSN 105
            |||  |..:|.|...:....|.|:       ||::.:|.....:|:.::.:.:|..:|.......
plant    49 QKTNNLNRLEAQRNELNSRVRMLR-------EELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGK 106

  Fly   106 YYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQPDEKPDVSYADIGGMDMQKQ 170
            |.|.|..:||...:.||..|||...|..|..|||.:.|..:::::.::.||.:|..|||:|.|.:
plant   107 YVVDIDKSIDITKITPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIK 171

  Fly   171 EIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTASFIRVVGSEFVQKYL 235
            ||:|.:|||:.|.||::.:||..|:|||:|||||.|||:||:||||||..:||||.|||.||||:
plant   172 EIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYI 236

  Fly   236 GEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTG-ADREVQRILLELLNQMDGFDQTTN 299
            |||.||||::|.:|:|:||:|||:||||:|.:.|.::.:| .|.||||.:||||||:|||:.:..
plant   237 GEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNK 301

  Fly   300 VKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITSKMNLSEDVDLEEFVARPDK 364
            :||:|||||.|.||.|||||||:|||||||.|:...:..:....:.||||...:||::...:.:.
plant   302 IKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMNLMRGIDLKKIAEKMNG 366

  Fly   365 ISGADINAICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKDEQEH 409
            .|||::.|:|.||||.|:||.|..|..:|||......:|||.:::
plant   367 ASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEKN 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt3NP_001285108.1 PTZ00454 22..413 CDD:240423 167/370 (45%)
AAA 197..330 CDD:278434 88/133 (66%)
RPT6ANP_001318606.1 RPT1 30..417 CDD:224143 167/370 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D571919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.