DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt3 and RPT5A

DIOPT Version :9

Sequence 1:NP_001285108.1 Gene:Rpt3 / 32047 FlyBaseID:FBgn0028686 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_187204.1 Gene:RPT5A / 819718 AraportID:AT3G05530 Length:424 Species:Arabidopsis thaliana


Alignment Length:408 Identity:165/408 - (40%)
Similarity:248/408 - (60%) Gaps:33/408 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EKDELSDLKLKDAHSSLDELDMEDLYVRYKKLQKTLEFIEVQEEYIKDEQRNLKKEYLHAQEEVK 75
            |:|:|:.:..:|...:...||.| :.:..:..|:|....:..:|.||:.           ||::|
plant    13 EEDQLASMSTEDITRATRLLDNE-IRILKEDAQRTNLECDSYKEKIKEN-----------QEKIK 65

  Fly    76 RIQSVPLVIGQFLEAVDQNTG---------------------IVGSTTGSNYYVRILSTIDRELL 119
            ..:.:|.::|..:|.::.|..                     ::.::|....::.::..:|.:.|
plant    66 LNKQLPYLVGNIVEILEMNPEDDAEEDGANIDLDSQRKGKCVVLKTSTRQTIFLPVVGLVDPDSL 130

  Fly   120 KPSASVALHKHSNALVDVLPPEADSSISMLQPDEKPDVSYADIGGMDMQKQEIREAVELPLTHFE 184
            ||...|.::|.|..::|.||.|.||.:..::.||||...|.||||::.|.||:.||:.||:||.|
plant   131 KPGDLVGVNKDSYLILDTLPSEYDSRVKAMEVDEKPTEDYNDIGGLEKQIQELVEAIVLPMTHKE 195

  Fly   185 LYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLA 249
            .::::|:.||:|||:|||||.|||::|:|.|..|.|:|:::.|.:.||.::|:|.::|||.|:||
plant   196 RFEKLGVRPPKGVLLYGPPGTGKTLMARACAAQTNATFLKLAGPQLVQMFIGDGAKLVRDAFQLA 260

  Fly   250 KENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDP 314
            ||.||.||||||||||.|||||::...||||||.:||||||:|||.....:|||.||||||.|||
plant   261 KEKAPCIIFIDEIDAIGTKRFDSEVSGDREVQRTMLELLNQLDGFSSDERIKVIAATNRADILDP 325

  Fly   315 ALLRPGRLDRKIEFPLPDRRQKRLVFSTITSKMNLSEDVDLEEFVARPDKISGADINAICQEAGM 379
            ||:|.||||||||||.|....:..:....:.|||:..||:.||.....|..:||.:.|:|.||||
plant   326 ALMRSGRLDRKIEFPHPTEEARARILQIHSRKMNVHPDVNFEELARSTDDFNGAQLKAVCVEAGM 390

  Fly   380 HAVRENRYIVLAKDFEKG 397
            .|:|.:...|..:||.:|
plant   391 LALRRDATEVNHEDFNEG 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt3NP_001285108.1 PTZ00454 22..413 CDD:240423 162/397 (41%)
AAA 197..330 CDD:278434 85/132 (64%)
RPT5ANP_187204.1 RPT1 29..417 CDD:224143 161/392 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1222
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D571919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.