DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt3 and RCA

DIOPT Version :10

Sequence 1:NP_572686.1 Gene:Rpt3 / 32047 FlyBaseID:FBgn0028686 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_565913.1 Gene:RCA / 818558 AraportID:AT2G39730 Length:474 Species:Arabidopsis thaliana


Alignment Length:193 Identity:43/193 - (22%)
Similarity:76/193 - (39%) Gaps:32/193 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 MYGPPGCGKTMLAKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFR----LAKENAPAIIFI 259
            ::|..|.||:...:.|......:.|.:...|......||..:::|..:|    |.|:.....:||
plant   163 IWGGKGQGKSFQCELVMAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADLIKKGKMCCLFI 227

  Fly   260 DEIDAIATKRFDAQTGADREVQRILLELLN--------QMDGF---DQTTNVKVIMATNRADTLD 313
            :::|| ...|....|......|.:...|:|        |:.|.   ::...|.:|...|...||.
plant   228 NDLDA-GAGRMGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENARVPIICTGNDFSTLY 291

  Fly   314 PALLRPGRLDRKIEFPLPDRRQKRL-----VFSTITSKMNLSEDVDLEEFVARPDKISGADIN 371
            ..|:|.||:::   |.....|:.|:     :|.|        :.:..|:.|...|:..|..|:
plant   292 APLIRDGRMEK---FYWAPTREDRIGVCKGIFRT--------DKIKDEDIVTLVDQFPGQSID 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt3NP_572686.1 PTZ00454 22..413 CDD:240423 43/193 (22%)
RCANP_565913.1 PLN00020 8..422 CDD:215031 43/193 (22%)
MPEG1_P2 450..>470 CDD:439345
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.