DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt3 and RPT2b

DIOPT Version :9

Sequence 1:NP_001285108.1 Gene:Rpt3 / 32047 FlyBaseID:FBgn0028686 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_179604.1 Gene:RPT2b / 816533 AraportID:AT2G20140 Length:443 Species:Arabidopsis thaliana


Alignment Length:374 Identity:197/374 - (52%)
Similarity:279/374 - (74%) Gaps:5/374 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VRYKKLQKTLEFIEVQEEYIKDEQRNLKKEYLHAQEE---VKRIQSVPLVIGQFLEAVDQNTGIV 98
            :|..||::..:::.::||::.:::| ||.:...|:|:   |..::..|:.:|...|.:|:|..||
plant    63 LRLLKLERIKDYLLMEEEFVANQER-LKPQEEKAEEDRSKVDDLRGTPMSVGNLEELIDENHAIV 126

  Fly    99 GSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQPDEKPDVSYADIG 163
            .|:.|..|||.|||.:|::.|:|..|:.:|....::|.:|..|.|..:|:::.::.|..||||||
plant   127 SSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVEKAPLESYADIG 191

  Fly   164 GMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTASFIRVVGS 228
            |::.|.|||:|||||||||.|||:.|||.||:||::||.||.|||:||||||:.|:|:|:|||||
plant   192 GLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGS 256

  Fly   229 EFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDG 293
            |.:|||||:||::||::||:|.:.:|:|:|||||||:.|||:||.:|.:||:||.:||||||:||
plant   257 ELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDANSGGEREIQRTMLELLNQLDG 321

  Fly   294 FDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITSKMNLSEDVDLEEF 358
            ||...:||||:||||.::||||||||||:||||||||||.:.:|.:|...||||.|:|||:||||
plant   322 FDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSKMTLAEDVNLEEF 386

  Fly   359 VARPDKISGADINAICQEAGMHAVRENRYIVLAKDFEKG-YKNNIKKDE 406
            |...|:.|||||.|||.|||:.|:||.|..|...||:|. .|...||.|
plant   387 VMTKDEFSGADIKAICTEAGLLALRERRMKVTHVDFKKAKEKVMFKKKE 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt3NP_001285108.1 PTZ00454 22..413 CDD:240423 197/374 (53%)
AAA 197..330 CDD:278434 88/132 (67%)
RPT2bNP_179604.1 PTZ00361 7..443 CDD:185575 197/374 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D571919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.