DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt3 and PSMC3

DIOPT Version :9

Sequence 1:NP_001285108.1 Gene:Rpt3 / 32047 FlyBaseID:FBgn0028686 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_016873515.1 Gene:PSMC3 / 5702 HGNCID:9549 Length:461 Species:Homo sapiens


Alignment Length:387 Identity:159/387 - (41%)
Similarity:238/387 - (61%) Gaps:28/387 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EKDELSDLKLKDAHSSLDELDMEDLYVRYKKLQKTLEFIEVQEEYIKDEQRNLKKEYLHAQEEVK 75
            |:|.:.:..||        :..|::..|.:.|...::.::.:...:..|.:.:|.:.....|::|
Human    25 EQDGIGEEVLK--------MSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIK 81

  Fly    76 RIQSVPLVIGQFLEAVD-----------------QNTG---IVGSTTGSNYYVRILSTIDRELLK 120
            ..:::|.::...:|.:|                 |..|   ::.::|...|::.::..:|.|.||
Human    82 VNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLK 146

  Fly   121 PSASVALHKHSNALVDVLPPEADSSISMLQPDEKPDVSYADIGGMDMQKQEIREAVELPLTHFEL 185
            |...|.::|.|..:::.||.|.||.:..::.||:|...|:||||:|.|.||:.||:.||:.|.|.
Human   147 PGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEK 211

  Fly   186 YKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAK 250
            ::.:||.||:|||||||||.|||:||:|.|..|.|:|:::.|.:.||.::|:|.::|||.|.|||
Human   212 FENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAK 276

  Fly   251 ENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPA 315
            |.||:||||||:|||.|||||::...||||||.:||||||:|||...|.||||.||||.|.||||
Human   277 EKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPA 341

  Fly   316 LLRPGRLDRKIEFPLPDRRQKRLVFSTITSKMNLSEDVDLEEFVARPDKISGADINAICQEA 377
            |||.||||||||||:|:...:..:....:.|||:|.||:.||.....|..:||...|:|.||
Human   342 LLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEA 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt3NP_001285108.1 PTZ00454 22..413 CDD:240423 155/376 (41%)
AAA 197..330 CDD:278434 88/132 (67%)
PSMC3XP_016873515.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.