DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt3 and psmc3

DIOPT Version :9

Sequence 1:NP_001285108.1 Gene:Rpt3 / 32047 FlyBaseID:FBgn0028686 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_005169019.1 Gene:psmc3 / 321947 ZFINID:ZDB-GENE-030131-666 Length:427 Species:Danio rerio


Alignment Length:404 Identity:161/404 - (39%)
Similarity:246/404 - (60%) Gaps:20/404 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ELDMEDLYVRYKKLQKTLEFIEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD- 92
            ::..|::..|.:.|...::.::.:...:..|.:.:|.:.....|::|..:::|.::...:|.:| 
Zfish    23 KMSTEEIVQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENTEKIKVNKTLPYLVSNVIELLDV 87

  Fly    93 ----------------QNTG---IVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVL 138
                            |..|   ::.::|...|::.::..:|.|.|||...|.::|.|..:::.|
Zfish    88 DPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETL 152

  Fly   139 PPEADSSISMLQPDEKPDVSYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPP 203
            |.|.||.:..::.||:|...|:||||:|.|.||:.||:.||:.|.|.::.:||.||:||||||||
Zfish   153 PTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPP 217

  Fly   204 GCGKTMLAKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATK 268
            |.|||:||:|.|..|.|:|:::.|.:.||.::|:|.::|||.|.||||.||:||||||:|||.||
Zfish   218 GTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTK 282

  Fly   269 RFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDR 333
            |||::...||||||.:||||||:|||.....||||.||||.|.|||||||.||||||||||:|:.
Zfish   283 RFDSEKAGDREVQRTMLELLNQLDGFQPNMQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNE 347

  Fly   334 RQKRLVFSTITSKMNLSEDVDLEEFVARPDKISGADINAICQEAGMHAVRENRYIVLAKDFEKGY 398
            ..:..:....:.|||:..||:.||.....|..:||...|:|.||||.|:|.....:..:|:.:|.
Zfish   348 EARARIMQIHSRKMNVCPDVNFEELARCTDDFNGAQCKAVCVEAGMIALRRGATELNHEDYMEGI 412

  Fly   399 KNNIKKDEQEHEFY 412
            .....|.:...::|
Zfish   413 LEVQAKKKANLQYY 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt3NP_001285108.1 PTZ00454 22..413 CDD:240423 161/404 (40%)
AAA 197..330 CDD:278434 87/132 (66%)
psmc3XP_005169019.1 RPT1 12..420 CDD:224143 160/396 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1222
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.