DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt3 and Psmc3

DIOPT Version :9

Sequence 1:NP_001285108.1 Gene:Rpt3 / 32047 FlyBaseID:FBgn0028686 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_113783.2 Gene:Psmc3 / 29677 RGDID:61905 Length:442 Species:Rattus norvegicus


Alignment Length:422 Identity:167/422 - (39%)
Similarity:254/422 - (60%) Gaps:28/422 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EKDELSDLKLKDAHSSLDELDMEDLYVRYKKLQKTLEFIEVQEEYIKDEQRNLKKEYLHAQEEVK 75
            |:|.:.:..||        :..|::..|.:.|...::.::.:...:..|.:.:|.:.....|::|
  Rat    28 EQDGIGEEVLK--------MSTEEIVQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIK 84

  Fly    76 RIQSVPLVIGQFLEAVD-----------------QNTG---IVGSTTGSNYYVRILSTIDRELLK 120
            ..:::|.::...:|.:|                 |..|   ::.::|...|::.::..:|.|.||
  Rat    85 VNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLK 149

  Fly   121 PSASVALHKHSNALVDVLPPEADSSISMLQPDEKPDVSYADIGGMDMQKQEIREAVELPLTHFEL 185
            |...|.::|.|..:::.||.|.||.:..::.||:|...|:||||:|.|.||:.||:.||:.|.|.
  Rat   150 PGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEK 214

  Fly   186 YKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAK 250
            ::.:||.||:|||||||||.|||:||:|.|..|.|:|:::.|.:.||.::|:|.::|||.|.|||
  Rat   215 FENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAK 279

  Fly   251 ENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPA 315
            |.||:||||||:|||.|||||::...||||||.:||||||:|||...|.||||.||||.|.||||
  Rat   280 EKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPA 344

  Fly   316 LLRPGRLDRKIEFPLPDRRQKRLVFSTITSKMNLSEDVDLEEFVARPDKISGADINAICQEAGMH 380
            |||.||||||||||:|:...:..:....:.|||:|.||:.||.....|..:||...|:|.||||.
  Rat   345 LLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMI 409

  Fly   381 AVRENRYIVLAKDFEKGYKNNIKKDEQEHEFY 412
            |:|.....:..:|:.:|......|.:...::|
  Rat   410 ALRRGATELTHEDYMEGILEVQAKKKANLQYY 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt3NP_001285108.1 PTZ00454 22..413 CDD:240423 163/411 (40%)
AAA 197..330 CDD:278434 88/132 (67%)
Psmc3NP_113783.2 RPT1 28..435 CDD:224143 166/414 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1222
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.