DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt3 and Psmc1

DIOPT Version :9

Sequence 1:NP_001285108.1 Gene:Rpt3 / 32047 FlyBaseID:FBgn0028686 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_476464.1 Gene:Psmc1 / 117263 RGDID:621097 Length:440 Species:Rattus norvegicus


Alignment Length:397 Identity:191/397 - (48%)
Similarity:291/397 - (73%) Gaps:10/397 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DELSDLKLKDAHSSLDELDMEDLYVRYKKLQKTLEFIEVQEEYIKDEQ--RNLKKEYLHAQEEVK 75
            |..|.|.|...|:        ...::..||::..:::.::||:|::::  :.|:::....:.:|.
  Rat    44 DAASKLPLVTPHT--------QCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVD 100

  Fly    76 RIQSVPLVIGQFLEAVDQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPP 140
            .::..|:.:|...|.:|.|..||.::.||.:||.|||.:|::||:|..||.|:...:|::.||..
  Rat   101 DLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMD 165

  Fly   141 EADSSISMLQPDEKPDVSYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGC 205
            :.|..:::::.::.|..:||||||:|.|.|||:|:|||||||.|.|:::||.||:||::|||||.
  Rat   166 DTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGT 230

  Fly   206 GKTMLAKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRF 270
            |||:||||||:.|:|:|:||||||.:|||||:||::||::||:|:|:||:|:||||||||.|||:
  Rat   231 GKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRY 295

  Fly   271 DAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQ 335
            |:.:|.:||:||.:||||||:||||...:|||||||||.:||||||:||||:||||||||||.:.
  Rat   296 DSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKT 360

  Fly   336 KRLVFSTITSKMNLSEDVDLEEFVARPDKISGADINAICQEAGMHAVRENRYIVLAKDFEKGYKN 400
            |:.:|...||:|.|::||.|::.:...|.:|||||.|||.|||:.|:||.|..|..:||:|..:|
  Rat   361 KKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKEN 425

  Fly   401 NIKKDEQ 407
            .:.|.::
  Rat   426 VLYKKQE 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt3NP_001285108.1 PTZ00454 22..413 CDD:240423 187/388 (48%)
AAA 197..330 CDD:278434 92/132 (70%)
Psmc1NP_476464.1 PTZ00361 1..440 CDD:185575 191/397 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104 2/19 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.