DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp60A and Bbs10

DIOPT Version :9

Sequence 1:NP_511115.2 Gene:Hsp60A / 32045 FlyBaseID:FBgn0015245 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_001102756.1 Gene:Bbs10 / 500832 RGDID:1560748 Length:713 Species:Rattus norvegicus


Alignment Length:203 Identity:37/203 - (18%)
Similarity:76/203 - (37%) Gaps:53/203 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LQGVDVLADAVAVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIELKDKFQNIGAKLVQDVANNT 101
            |:..:||.......:||:|..|:..:..|...:::||..:.:::.|:...    |:::....::.
  Rat    11 LRVAEVLETIANRCVGPEGGLVLCTKPTGEVLLSRDGGCLLEALHLEHPL----ARMIVACVSSH 71

  Fly   102 NEEAGDGTTTATVLARAIAKEGFEKISKGANPVEIRRGVMLAVETVKDNLKTMSRPVSTPEEI-- 164
            .::.|||..|..:..                 ..:.||:....|..||:.        |.|:|  
  Rat    72 LKKTGDGAKTFIIFL-----------------CHLLRGLHAIGEKEKDSF--------TSEDIQS 111

  Fly   165 --------AQVATISAN----GDQAIGNLISEAMKKVGRDGVITVKDGKTL-TDELEVIEGMKFD 216
                    .|..:||..    ..|.:|.::.:.:.:.......:..:|:|| ...||::      
  Rat   112 HERHWKNCCQWKSISRALLRFQTQTLGCIVDQHLSRHYLSAFSSSAEGRTLCRRSLELL------ 170

  Fly   217 RGYISPYF 224
               :.|||
  Rat   171 ---LEPYF 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp60ANP_511115.2 PTZ00114 12..549 CDD:185455 37/203 (18%)
GroEL 24..544 CDD:239460 37/203 (18%)
Bbs10NP_001102756.1 chaperonin_like 7..>94 CDD:295468 18/103 (17%)
Cpn60_TCP1 13..>424 CDD:278544 36/201 (18%)
Glyco_tranf_GTA_type <589..>673 CDD:299700
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.