Sequence 1: | NP_511115.2 | Gene: | Hsp60A / 32045 | FlyBaseID: | FBgn0015245 | Length: | 573 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001102756.1 | Gene: | Bbs10 / 500832 | RGDID: | 1560748 | Length: | 713 | Species: | Rattus norvegicus |
Alignment Length: | 203 | Identity: | 37/203 - (18%) |
---|---|---|---|
Similarity: | 76/203 - (37%) | Gaps: | 53/203 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 LQGVDVLADAVAVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIELKDKFQNIGAKLVQDVANNT 101
Fly 102 NEEAGDGTTTATVLARAIAKEGFEKISKGANPVEIRRGVMLAVETVKDNLKTMSRPVSTPEEI-- 164
Fly 165 --------AQVATISAN----GDQAIGNLISEAMKKVGRDGVITVKDGKTL-TDELEVIEGMKFD 216
Fly 217 RGYISPYF 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hsp60A | NP_511115.2 | PTZ00114 | 12..549 | CDD:185455 | 37/203 (18%) |
GroEL | 24..544 | CDD:239460 | 37/203 (18%) | ||
Bbs10 | NP_001102756.1 | chaperonin_like | 7..>94 | CDD:295468 | 18/103 (17%) |
Cpn60_TCP1 | 13..>424 | CDD:278544 | 36/201 (18%) | ||
Glyco_tranf_GTA_type | <589..>673 | CDD:299700 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0459 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |