DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2061 and GPCR

DIOPT Version :9

Sequence 1:NP_001259437.1 Gene:CG2061 / 32042 FlyBaseID:FBgn0027498 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_175700.2 Gene:GPCR / 841725 AraportID:AT1G52920 Length:410 Species:Arabidopsis thaliana


Alignment Length:439 Identity:140/439 - (31%)
Similarity:223/439 - (50%) Gaps:59/439 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERRYLKNPFPDF-----AGGENT--------------PFASDEEHIKNLICTYVDAILEHCHPN 46
            |..|:.:|..|:|     :|.|.|              |:.|..|.:.....:..|.::......
plant     1 MGERFFRNEMPEFVPEDLSGEEETVTECKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVWETWER 65

  Fly    47 SDDEDNRGDLYVGNAGIAFMFWKLNSCEQTR---DLYPALDHAASFIRNAKVNANRYKKRSAERY 108
            |.......:||.|..|.|::.:|  |.:.||   ||...|::         |.|.....|.:||.
plant    66 SGKRVRDYNLYTGVLGTAYLLFK--SYQVTRNEDDLKLCLEN---------VEACDVASRDSERV 119

  Fly   109 SFLCGNAGIYAVSAAISQALKETEELSDDLANFKSGIPCSKEFMHTKYGCDEVLVGRAGYLSGCY 173
            :|:||.||:.|:.|..::.|.:.:.....||.|: ||....:..:      |:|.||||||..|.
plant   120 TFICGYAGVCALGAVAAKCLGDDQLYDRYLARFR-GIRLPSDLPY------ELLYGRAGYLWACL 177

  Fly   174 WLNDVLPEKKITDDDLVSICQLIVTSGREYSKQNNSPCPLMYQYHGTEYLGAAHGLCAILHMLLD 238
            :||..:.::.|:.:.:.|:.:.|..:||:..  |...|||||::||..|.||||||..|:::|:.
plant   178 FLNKHIGQESISSERMRSVVEEIFRAGRQLG--NKGTCPLMYEWHGKRYWGAAHGLAGIMNVLMH 240

  Fly   239 SPWFRTLPISAPAAELRDIKRSIDFFLELQDSDGNFPVALEDLRSGRDKRLVHWCHGAPGAVYVL 303
            :        .....|::|:|.::.:.::.:...||: ::.|..:|   .|||||||||||....|
plant   241 T--------ELEPDEIKDVKGTLSYMIQNRFPSGNY-LSSEGSKS---DRLVHWCHGAPGVALTL 293

  Fly   304 AKAYLIFKEEKYLASLRRCADMVWKKGFLRKGPGICHGVAGNGYVFLLLFRLTNEMRYLYRAHKF 368
            .||..::..::::.:.....::||.:|.|:: .|||||::||.||||.|:|||...:|||||..|
plant   294 VKAAQVYNTKEFVEAAMEAGEVVWSRGLLKR-VGICHGISGNTYVFLSLYRLTRNPKYLYRAKAF 357

  Fly   369 MELLTNAEFKL----RARTPDRPHSLYEGVAGTVCYLVDLLEPEQAYFP 413
            ...|.:...||    :....|||.||:||:.|....|:|:.:|.||.||
plant   358 ASFLLDKSEKLISEGQMHGGDRPFSLFEGIGGMAYMLLDMNDPTQALFP 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2061NP_001259437.1 euk_LANCL 56..413 CDD:271202 125/363 (34%)
GPCRNP_175700.2 euk_LANCL 75..406 CDD:271202 125/363 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 209 1.000 Domainoid score I804
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 214 1.000 Inparanoid score I1233
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681208at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3033
orthoMCL 1 0.900 - - OOG6_101476
Panther 1 1.100 - - O PTHR12736
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X807
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.