DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2061 and lancl1

DIOPT Version :9

Sequence 1:NP_001259437.1 Gene:CG2061 / 32042 FlyBaseID:FBgn0027498 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001009891.1 Gene:lancl1 / 494154 ZFINID:ZDB-GENE-040924-1 Length:405 Species:Danio rerio


Alignment Length:444 Identity:149/444 - (33%)
Similarity:233/444 - (52%) Gaps:69/444 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERRYLKNPFPDFAG-----------GENTPFASDEEHIKNLICTYVD---AILEHCHPNSDDEDN 52
            |:|.||||:||:.|           |..|      :|....|.:.:.   ||||:...|:|..|.
Zfish     3 EQRALKNPYPDYTGLGCAQDLFDMQGNLT------QHFATSISSKISELLAILENGLKNADPRDC 61

  Fly    53 RGDLYVGNAGIAFMFWKLNSCEQTRDLYPALDHAASFIRNAKVNANRYKKRSAERY-SFLCGNAG 116
            .|  |.|.||||.::..|:|          :....:|::.|....||..:...:|: :||||:||
Zfish    62 TG--YTGWAGIALLYLHLHS----------VFGDPTFLQRALDYVNRSLRSLTQRWVTFLCGDAG 114

  Fly   117 IYAVSAAISQALKETEELSDDLAN-----------FKSGIPCSKEFMHTKYGCDEVLVGRAGYLS 170
            ..|::|.:...|::.:| ||:..|           .|..:|            ||:|.||.|||.
Zfish   115 PLAIAAVVYHRLQKHQE-SDECLNRLLQLQPSVVQGKGRLP------------DELLYGRTGYLY 166

  Fly   171 GCYWLNDVLPEKKITDDDLVSICQLIVTSGREYSKQN--NSPCPLMYQYHGTEYLGAAHGLCAIL 233
            ...::|....::||....:..||..|:.||:..|::|  ....||||:::..||:||||||..|.
Zfish   167 SLIFVNQQFQQEKIPFQYIQQICDAILESGQILSQRNKIQDQSPLMYEWYQEEYVGAAHGLSGIY 231

  Fly   234 HMLLDSPWFRTLPISAPAAELRDIKRSIDFFLELQDSDGNFPVALEDLRSGRDKRLVHWCHGAPG 298
            :.|: .|..    ::........:|.|:::..:|:...||:...:.|.|.    .|||||||:||
Zfish   232 YYLM-QPGL----VAGQDRVFSLVKPSVNYVCQLKFPSGNYAPCVGDARD----LLVHWCHGSPG 287

  Fly   299 AVYVLAKAYLIFKEEKYLASLRRCADMVWKKGFLRKGPGICHGVAGNGYVFLLLFRLTNEMRYLY 363
            .:|:|.:|:.:|...:||....:|.:::|::|.|:||.|:|||.|||.|.||.|:::|.:.::||
Zfish   288 VIYMLIQAFKVFGVRQYLEDALQCGEVIWQRGLLKKGYGLCHGAAGNAYGFLALYKITQDPKHLY 352

  Fly   364 RAHKFMELLTNAEFKLRARTPDRPHSLYEGVAGTVCYLVDLLEPEQAYFPFMDV 417
            ||..|.:...|.. :...||||.|.||:||:|||:.:|.|||:|.:|.||..:|
Zfish   353 RACMFADWCMNYG-RHGCRTPDTPFSLFEGMAGTIYFLADLLQPARAKFPCFEV 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2061NP_001259437.1 euk_LANCL 56..413 CDD:271202 125/370 (34%)
lancl1NP_001009891.1 euk_LANCL 64..401 CDD:271202 125/369 (34%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:O43813 370..373 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574257
Domainoid 1 1.000 230 1.000 Domainoid score I2387
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 233 1.000 Inparanoid score I3390
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D316897at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24725
orthoMCL 1 0.900 - - OOG6_101476
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X807
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.