DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2061 and Lancl1

DIOPT Version :9

Sequence 1:NP_001259437.1 Gene:CG2061 / 32042 FlyBaseID:FBgn0027498 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_446175.1 Gene:Lancl1 / 114515 RGDID:69416 Length:399 Species:Rattus norvegicus


Alignment Length:438 Identity:158/438 - (36%)
Similarity:236/438 - (53%) Gaps:60/438 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERRYLKNPFPDF----------AGGENTPFASDE--EHIKNLICTYVDAILEHCHPNSDDEDNR 53
            |.:|...||:.|:          :.|..||..|..  ..|:.|:     ..:|....::|.:|..
  Rat     1 MAQRAFPNPYADYNKSLAENYFDSTGRLTPEFSHRLTNKIRELL-----QQMERGLKSADPQDGT 60

  Fly    54 GDLYVGNAGIAFMFWKLNSCEQTRDLYPA-LDHAASFIRNAKVNANRYKKRSAERYSFLCGNAGI 117
            |  |.|.||||.::..|::....    || |..|.|::::   :.|...:||   .:||||:||.
  Rat    61 G--YTGWAGIAVLYLHLHNVFGD----PAYLQMAHSYVKH---SLNCLSRRS---ITFLCGDAGP 113

  Fly   118 YAVSAAISQALKETEELSDDLANFKSGIPCSKEFMHTK----YGCDEVLVGRAGYLSGCYWLNDV 178
            .||:|.:...:...::..|          |....:|..    :..:|:|.||.||:....::|..
  Rat   114 LAVAAVLYHKMNSGKQAED----------CITRLIHLNKIDPHVPNEMLYGRIGYIFALLFVNKN 168

  Fly   179 LPEKKITDDDLVSICQLIVTSGREYSKQNN--SPCPLMYQYHGTEYLGAAHGLCAILHMLLDSPW 241
            ..|:||....:..||:.|:|||.:.|::.|  :..||||:::...|:||||||..|.:.|:..  
  Rat   169 FGEEKIPQSHIQQICETILTSGEKLSRKRNFTTKSPLMYEWYQEYYVGAAHGLAGIYYYLMQP-- 231

  Fly   242 FRTLPISAPAAELRD-IKRSIDFFLELQDSDGNFPVALEDLRSGRDKRLVHWCHGAPGAVYVLAK 305
              :|.:|  ..:|.. :|.|:||..:|:...||:|..|:|.|.    .||||||||||.:|:|.:
  Rat   232 --SLHVS--QGKLHSLVKPSVDFVCQLKFPSGNYPSCLDDTRD----LLVHWCHGAPGVIYMLIQ 288

  Fly   306 AYLIFKEEKYLASLRRCADMVWKKGFLRKGPGICHGVAGNGYVFLLLFRLTNEMRYLYRAHKFME 370
            ||.:||||.||...::|||::|:.|.|:||.|:|||.|||.|.||.|:.||.:.:|||||.||.|
  Rat   289 AYKVFKEEHYLCDAQQCADVIWQYGLLKKGYGLCHGAAGNAYAFLALYNLTQDAKYLYRACKFAE 353

  Fly   371 -LLTNAEFKLRARTPDRPHSLYEGVAGTVCYLVDLLEPEQAYFPFMDV 417
             .|...|.  ..||||.|.||:||:|||:.:|.|||.|.:|.||..::
  Rat   354 WCLDYGEH--GCRTPDTPFSLFEGMAGTIYFLADLLVPTKAKFPAFEL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2061NP_001259437.1 euk_LANCL 56..413 CDD:271202 141/365 (39%)
Lancl1NP_446175.1 LanC_like <1..>94 CDD:414247 27/103 (26%)
euk_LANCL 62..395 CDD:271202 141/364 (39%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:O43813 364..367 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335023
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D316897at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101476
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X807
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.