DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2061 and LANCL1

DIOPT Version :9

Sequence 1:NP_001259437.1 Gene:CG2061 / 32042 FlyBaseID:FBgn0027498 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_005246300.1 Gene:LANCL1 / 10314 HGNCID:6508 Length:411 Species:Homo sapiens


Alignment Length:442 Identity:158/442 - (35%)
Similarity:234/442 - (52%) Gaps:68/442 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERRYLKNPFPDF----------AGGENTPFASDEEHIKNLICTYVDAILEHCHPNSDDEDNRGD 55
            |.:|...||:.|:          |.|..||..|  :.:.|.|...:.. :|....::|..|..| 
Human    13 MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFS--QRLTNKIRELLQQ-MERGLKSADPRDGTG- 73

  Fly    56 LYVGNAGIAFMFWKLNSCEQTRDLY--PA-LDHAASFIRNAKVNANRYKKRSAERYSFLCGNAGI 117
             |.|.||||.::..|      .|::  || |..|..::   |.:.|...|||   .:||||:||.
Human    74 -YTGWAGIAVLYLHL------YDVFGDPAYLQLAHGYV---KQSLNCLTKRS---ITFLCGDAGP 125

  Fly   118 YAVSAAISQALKETEELSDDLANFKSGIPCSKEFMHTK----YGCDEVLVGRAGYLSGCYWLNDV 178
            .||:|.:...:...::..|          |....:|..    :..:|:|.||.||:....::|..
Human   126 LAVAAVLYHKMNNEKQAED----------CITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKN 180

  Fly   179 LPEKKITDDDLVSICQLIVTSGREYSKQNN--SPCPLMYQYHGTEYLGAAHGLCAILHMLLDSPW 241
            ...:||....:..||:.|:|||...:::.|  :..||||:::...|:||||||..|.:.|:..  
Human   181 FGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQP-- 243

  Fly   242 FRTLPISAPAAELRD-IKRSIDFFLELQDSDGNFPVALEDLRSGRDKRLVHWCHGAPGAVYVLAK 305
              :|.:|  ..:|.. :|.|:|:..:|:...||:|..:.|.|.    .||||||||||.:|:|.:
Human   244 --SLQVS--QGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRD----LLVHWCHGAPGVIYMLIQ 300

  Fly   306 AYLIFKEEKYLASLRRCADMVWKKGFLRKGPGICHGVAGNGYVFLLLFRLTNEMRYLYRAHKFME 370
            ||.:|:|||||....:|||::|:.|.|:||.|:|||.|||.|.||.|:.||.:|:|||||.||  
Human   301 AYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKF-- 363

  Fly   371 LLTNAEFKLR-----ARTPDRPHSLYEGVAGTVCYLVDLLEPEQAYFPFMDV 417
                ||:.|.     .||||.|.||:||:|||:.:|.|||.|.:|.||..::
Human   364 ----AEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2061NP_001259437.1 euk_LANCL 56..413 CDD:271202 140/371 (38%)
LANCL1XP_005246300.1 LanC_like <13..>101 CDD:383935 27/98 (28%)
euk_LANCL 74..407 CDD:271202 140/370 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141352
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D316897at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101476
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X807
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.