DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2076 and AT5G47130

DIOPT Version :9

Sequence 1:NP_001285107.1 Gene:CG2076 / 32041 FlyBaseID:FBgn0030263 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001332047.1 Gene:AT5G47130 / 834759 AraportID:AT5G47130 Length:226 Species:Arabidopsis thaliana


Alignment Length:216 Identity:53/216 - (24%)
Similarity:93/216 - (43%) Gaps:34/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 FFGGSCVLTAAAAAATFRSHRLLELASRGGILATIASLALVIGSGAVARSIEYQPGLGAKH---- 187
            :|...|:|.|:|..|..  |..|.:   ||   ||..|..|:  ..:...:...|   .||    
plant    22 YFSLFCILAASAFGAYL--HMRLNI---GG---TITKLGWVL--SLLEHVVSCPP---YKHKIRF 73

  Fly   188 ----LAWAVHCAILGAVIAPICFMGGPILTRAALYTGGIVGGLSTIAACAPSDKFLYMGGPLAIG 248
                |...:|.|.:|..|.....:...||..|.|.|..|....|.:|..|...:::|:||.|:.|
plant    74 SLLLLFGVLHGASVGPCIKSTIDIDSSILITAFLGTAVIFFCFSAVAMLARRREYIYLGGLLSSG 138

  Fly   249 LGVVFASSLASMWLPPTTALGAGLASMSLYGGLVLFSGFLLYDTQRMVRRAEVYPQYSYTPYDPI 313
            ..::       .||..:....:....:.:|.||:||.|.::.:||.::.:|.. ....|..:   
plant   139 FSLL-------TWLKNSDQFASATVEIQMYLGLLLFVGCIVVNTQEIIEKAHC-GDMDYAVH--- 192

  Fly   314 NASMSIYMDVLNIFIRIVTIL 334
              |:.:|:..:.:|::|::|:
plant   193 --SLILYIGFVRVFLQILSIM 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2076NP_001285107.1 GHITM 93..341 CDD:198413 53/216 (25%)
AT5G47130NP_001332047.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.