DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2076 and AT4G15470

DIOPT Version :9

Sequence 1:NP_001285107.1 Gene:CG2076 / 32041 FlyBaseID:FBgn0030263 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_567466.1 Gene:AT4G15470 / 827218 AraportID:AT4G15470 Length:256 Species:Arabidopsis thaliana


Alignment Length:267 Identity:63/267 - (23%)
Similarity:112/267 - (41%) Gaps:66/267 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VGLGKQT-----SIADNAIMWPQFVRDRIQSTYAFFGGSCVLTAAAAAATFRSHRLLELASRG-G 156
            :|:|:.|     |..:|.:.| .|:|    ..|.......:||...:|....:..:.:|.:.. |
plant    27 MGVGEATLYPGLSYGENQLRW-GFIR----KVYGILSAQLLLTTLISAVVVLNPPVNDLLTGSPG 86

  Fly   157 ILATIASLALVIGSGAVARSIEYQPGLGAKHLAWAVH----------------CAILGAVIAPIC 205
            ||..:..:..:                    |.|.:|                ...|...:...|
plant    87 ILLFLCIVPFI--------------------LIWPLHIYHQKHPVNLILLALFTVSLSFTVGVSC 131

  Fly   206 FM-GGPILTRAALYTGGIVGGLS--TIAACAPSDKFLYMGGPLAIGLGVVFASSLASMWLPPTTA 267
            .| .|.|:.:|.:.|..:||.|:  |..|......|.::|..|...|.::..:|...|:.|    
plant   132 AMTEGRIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILVVTSFIQMFFP---- 192

  Fly   268 LGAGLASMSLYGGL--VLFSGFLLYDTQRMVRRAEVYPQYSYTPYDPINASMSIYMDVLNIFIRI 330
              .|..|:::|||.  ::|.|:::|||..:::|      ::|..|  |.||:::|:|:||:|:.|
plant   193 --LGPTSVAVYGGFSALVFCGYIVYDTDNLIKR------FTYDEY--ILASVALYLDILNLFLTI 247

  Fly   331 VTILSGG 337
            :.||..|
plant   248 LRILRQG 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2076NP_001285107.1 GHITM 93..341 CDD:198413 63/267 (24%)
AT4G15470NP_567466.1 GAAP_like 16..255 CDD:198411 63/267 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23291
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.