DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2076 and CG9722

DIOPT Version :9

Sequence 1:NP_001285107.1 Gene:CG2076 / 32041 FlyBaseID:FBgn0030263 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_650341.1 Gene:CG9722 / 41724 FlyBaseID:FBgn0038209 Length:264 Species:Drosophila melanogaster


Alignment Length:257 Identity:60/257 - (23%)
Similarity:108/257 - (42%) Gaps:18/257 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 AAAVGLGALCYYGVGLGKQTSIADNAIMWPQFVRDRIQSTYAFFGGSCVLTAAAAAATFRSHRLL 149
            |..:.||....||..:|:...............|..|:..|.......:.:.....:.....|:.
  Fly    19 AECIPLGRYTAYGSEIGQDDPDKGLGFCSASIRRGFIRKVYLILLAQLITSLVVIVSLTADKRVR 83

  Fly   150 ELASRGGILATIASLALVIGSGAVARSIEYQPGLGAKHL---AWAVHCAILGAVIAPICFMGGPI 211
            .:.:....:..:|.|.:|....|:..:.:.:....|..:   |:.:..:.|..|.|  |......
  Fly    84 LMVAESTWIFVVAILIVVFSLVALGCNEDLRRQTPANFIFLSAFTIAESFLLGVAA--CRYAPME 146

  Fly   212 LTRAALYTGGIVGGLSTIAACAPSDKFLYMGGPLAIGLGVVFASSLASMWLPPTTALGAGLASMS 276
            :..|.|.|..:..||:..|.....| |..|||.|...|.::....:.::::       .|....:
  Fly   147 IFMAVLITASVCLGLTLFALQTRYD-FTVMGGLLVSCLIILLFFGIVTIFV-------GGHMVTT 203

  Fly   277 LYGGL--VLFSGFLLYDTQRMVRRAEVYPQYSYTPYDPINASMSIYMDVLNIFIRIVTILSG 336
            :|..|  :|||.:|:||||.|:....   :||.:|.:.|.|:::|||||:|||:.|:.::.|
  Fly   204 IYASLSALLFSVYLVYDTQLMMGGKH---RYSISPEEYIFAALNIYMDVMNIFLDILQLIGG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2076NP_001285107.1 GHITM 93..341 CDD:198413 57/249 (23%)
CG9722NP_650341.1 LFG_like 44..261 CDD:198410 53/229 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439721
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.