DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2076 and BI-1

DIOPT Version :9

Sequence 1:NP_001285107.1 Gene:CG2076 / 32041 FlyBaseID:FBgn0030263 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_648205.1 Gene:BI-1 / 38936 FlyBaseID:FBgn0035871 Length:245 Species:Drosophila melanogaster


Alignment Length:255 Identity:68/255 - (26%)
Similarity:110/255 - (43%) Gaps:49/255 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 GLGKQTSIADNAIMWPQFVRDRIQSTYAFFGGSCVLTAAAAAATFRSHRLLELASRGGILATIAS 163
            |||.:         :..:||:.:...|...|.:...||..|....|.  .|:|    |:||.:|:
  Fly    18 GLGDR---------YEPYVREHLSKVYMVLGSTAAATAMGAMLQMRD--FLDL----GVLAAVAT 67

  Fly   164 LALVIG------SGAVARSIEYQPGLGAKHLAWAVHCAILGAVIAPICFMGGPILTRAALYTGGI 222
            |.||:|      .|.     .|...||..:.........||.::..||.: .|.:..:|| ||..
  Fly    68 LVLVLGLHFYKDDGK-----NYYTRLGMLYAFGFCSGQTLGPLLGYICSI-NPAIILSAL-TGTF 125

  Fly   223 VG--GLSTIAACAPSDKFLYMGGPLAIGLGVVFASSLASM----WLPPTTALGAGLASMSLYGGL 281
            |.  .||..|..|...|:||:||.|...:..:...||.:|    :....|         .||.|:
  Fly   126 VTFISLSLSALLAEQGKYLYLGGMLVSVINTMALLSLFNMVFKSYFVQVT---------QLYVGV 181

  Fly   282 VLFSGFLLYDTQRMVRRAEVYPQYSYTPYDPINASMSIYMDVLNIFIRIVTILSGGQRRK 341
            .:.:.|::||||.:|.:.....:      |.:..::.::.|||::|.|::.||:..:.||
  Fly   182 FVMAAFIVYDTQNIVEKCRNGNR------DVVQHALDLFFDVLSMFRRLLIILTQKEERK 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2076NP_001285107.1 GHITM 93..341 CDD:198413 66/253 (26%)
BI-1NP_648205.1 BI-1 21..233 CDD:198412 63/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439713
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.