DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2076 and Nmda1

DIOPT Version :9

Sequence 1:NP_001285107.1 Gene:CG2076 / 32041 FlyBaseID:FBgn0030263 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_523722.1 Gene:Nmda1 / 36419 FlyBaseID:FBgn0013305 Length:324 Species:Drosophila melanogaster


Alignment Length:296 Identity:76/296 - (25%)
Similarity:115/296 - (38%) Gaps:81/296 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PPSANAYSMGKGAAAGAAAVGLGALCYYGVGLGKQTSIADNAIMWPQFVRDRIQSTYAFFGGSCV 133
            ||||..|    ||.....:            ..|..|..|.:|.     |..|:..|....|..:
  Fly    83 PPSAGGY----GAYDDPES------------QPKNFSFDDQSIR-----RGFIRKVYLILMGQLI 126

  Fly   134 LTAAAAA--------ATF-RSHRLLELASRGGILATIASLALVIGSGAVARSIEYQPGLGAKHLA 189
            :|..|.|        .|| |::..|...:.|.:|.|:.|:       |...|:..|.        
  Fly   127 VTFGAVALFVYHEGTKTFARNNMWLFWVALGVMLVTMLSM-------ACCESVRRQT-------- 176

  Fly   190 WAVHCAILGAVIAPICFMGGPILTRAA----LYTGGIVGGLS---TIAACAPSDKFLYMGGPLAI 247
             ..:...||...|...|:.|...|:.|    |...||...:.   ||.|......|..||| :.|
  Fly   177 -PTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGG-ILI 239

  Fly   248 GLGVVFASSLASMWLPPTTALGAGLASMSLYG----------GLVLFSGFLLYDTQRMVRRAEVY 302
            ...|||              |..|:.::.:.|          |.:|||.:|:||||.|:....  
  Fly   240 ACMVVF--------------LIFGIVAIFVKGKIITLVYASIGALLFSVYLIYDTQLMMGGEH-- 288

  Fly   303 PQYSYTPYDPINASMSIYMDVLNIFIRIVTILSGGQ 338
             :||.:|.:.|.|::::|:|::|||:.|:||:...:
  Fly   289 -KYSISPEEYIFAALNLYLDIINIFMYILTIIGASR 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2076NP_001285107.1 GHITM 93..341 CDD:198413 69/272 (25%)
Nmda1NP_523722.1 LFG_like 103..320 CDD:198410 68/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439719
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.