DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2076 and Lfg

DIOPT Version :9

Sequence 1:NP_001285107.1 Gene:CG2076 / 32041 FlyBaseID:FBgn0030263 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_725236.1 Gene:Lfg / 36418 FlyBaseID:FBgn0025692 Length:244 Species:Drosophila melanogaster


Alignment Length:139 Identity:44/139 - (31%)
Similarity:71/139 - (51%) Gaps:12/139 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 ILGAVIAPICFMGGPILTRAALYTGGIVGGLSTIAACAPSDKFLYMGGPLAIGLGVVFASSLASM 260
            :||.|...  |....:|....: |..:..||:..|.....| |...||.|...|.|.....:.::
  Fly   113 LLGMVAGQ--FEADEVLMAVGI-TAAVALGLTLFALQTKYD-FTMCGGVLVACLVVFIIFGIIAI 173

  Fly   261 WLPPTTALGAGLASMSLYGGLVLFSGFLLYDTQRMVRRAEVYPQYSYTPYDPINASMSIYMDVLN 325
            ::|...   .||...||  |.:|||.:|:||||.|:....   :||.:|.:.|.|::::|:|::|
  Fly   174 FIPGKV---IGLVYASL--GALLFSVYLVYDTQLMLGGNH---KYSISPEEYIFAALNLYLDIIN 230

  Fly   326 IFIRIVTIL 334
            ||:.|:||:
  Fly   231 IFMYILTII 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2076NP_001285107.1 GHITM 93..341 CDD:198413 44/139 (32%)
LfgNP_725236.1 LFG_like 23..240 CDD:198410 44/139 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439720
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.