DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vago and CG34177

DIOPT Version :9

Sequence 1:NP_001285106.1 Gene:Vago / 32040 FlyBaseID:FBgn0030262 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001097081.1 Gene:CG34177 / 5740338 FlyBaseID:FBgn0085206 Length:107 Species:Drosophila melanogaster


Alignment Length:44 Identity:14/44 - (31%)
Similarity:19/44 - (43%) Gaps:1/44 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 QCVRIQCLETLQLWEDSCQVPKLTQGNCTPVPSTNPHAEYPRCC 101
            :|.:|.|....::...||.|..|:. .|......||...||.||
  Fly    58 ECRKILCGLNGRVVYHSCGVSILSP-PCRYGDYINPDLPYPDCC 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VagoNP_001285106.1 SVWC 41..106 CDD:292070 14/44 (32%)
CG34177NP_001097081.1 SVWC 38..102 CDD:292070 14/44 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.