powered by:
Protein Alignment Vago and CG34177
DIOPT Version :9
Sequence 1: | NP_001285106.1 |
Gene: | Vago / 32040 |
FlyBaseID: | FBgn0030262 |
Length: | 160 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097081.1 |
Gene: | CG34177 / 5740338 |
FlyBaseID: | FBgn0085206 |
Length: | 107 |
Species: | Drosophila melanogaster |
Alignment Length: | 44 |
Identity: | 14/44 - (31%) |
Similarity: | 19/44 - (43%) |
Gaps: | 1/44 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 QCVRIQCLETLQLWEDSCQVPKLTQGNCTPVPSTNPHAEYPRCC 101
:|.:|.|....::...||.|..|:. .|......||...||.||
Fly 58 ECRKILCGLNGRVVYHSCGVSILSP-PCRYGDYINPDLPYPDCC 100
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Vago | NP_001285106.1 |
SVWC |
41..106 |
CDD:292070 |
14/44 (32%) |
CG34177 | NP_001097081.1 |
SVWC |
38..102 |
CDD:292070 |
14/44 (32%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR39957 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.