DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vago and CG2444

DIOPT Version :9

Sequence 1:NP_001285106.1 Gene:Vago / 32040 FlyBaseID:FBgn0030262 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001285135.1 Gene:CG2444 / 32121 FlyBaseID:FBgn0030326 Length:114 Species:Drosophila melanogaster


Alignment Length:111 Identity:29/111 - (26%)
Similarity:42/111 - (37%) Gaps:17/111 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YLVAMMSLIIGGSQAIPYRPSAYLYNQQY---C-MDTLTGRQLYIGEVFTRED-QCVRIQC---- 64
            :|:..:.:|:||...........|.|..:   | :||.|  .|..||.....| .|||.:|    
  Fly    10 FLLLGLVVILGGHVGQAAVAKVKLNNSSHPGKCVLDTNT--ILSPGETGLAPDLPCVRAECHADG 72

  Fly    65 LETLQLWEDSCQVPKLTQGNCTPVPSTNPHAEYPRCCP-LYECKSY 109
            |.|.:..:.....|     .|......|.:.|:|.||. .|.|..:
  Fly    73 LVTFKTCDAVAPPP-----GCKQRDFVNINREFPACCERKYNCDKH 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VagoNP_001285106.1 SVWC 41..106 CDD:292070 20/70 (29%)
CG2444NP_001285135.1 SVWC 42..110 CDD:292070 22/74 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.