DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vago and CG15199

DIOPT Version :9

Sequence 1:NP_001285106.1 Gene:Vago / 32040 FlyBaseID:FBgn0030262 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001245617.1 Gene:CG15199 / 32051 FlyBaseID:FBgn0030270 Length:116 Species:Drosophila melanogaster


Alignment Length:110 Identity:25/110 - (22%)
Similarity:46/110 - (41%) Gaps:14/110 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SMIYLVAMMSLIIGGSQ-AIPYR-----PSA---YLYNQQYCMDTLTGRQLYIGEVFTREDQCVR 61
            |:.::..:::..:.|:. :..||     ||.   .||.:......|.|..|..|:    :..|:|
  Fly     8 SLAFVACLLAASVDGNGFSTQYRGHTQHPSLAEHCLYEELDLAVPLNGYVLPSGQ----QGYCIR 68

  Fly    62 IQCLETLQLWEDSCQVPKLTQGNCTPVPSTNPHAEYPRCCPLYEC 106
            ::|.:...|....|......:..|...|: :...::|.|||..||
  Fly    69 LECTDDYLLLIRHCDKQPWPRPGCHLSPN-DYDFKFPECCPQLEC 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VagoNP_001285106.1 SVWC 41..106 CDD:292070 15/64 (23%)
CG15199NP_001245617.1 SVWC 53..112 CDD:292070 15/63 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469177
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.