DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA7 and Ubx

DIOPT Version :9

Sequence 1:NP_008827.2 Gene:HOXA7 / 3204 HGNCID:5108 Length:230 Species:Homo sapiens
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:249 Identity:97/249 - (38%)
Similarity:114/249 - (45%) Gaps:85/249 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    26 PTSCSFAPNSQRSGY------------GAGAGAFASTVPGLYNVNSPLYQSPFASGYGL-GADAY 77
            |::|:  |:|:..||            |..||...|...|  |.|:...|    ||.|: ||...
  Fly   155 PSACT--PDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGG--NGNAGGVQ----SGVGVAGAGTA 211

Human    78 GNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGAAEANFRIYPWMRSSG--------------- 127
            .|..|     .|.|..:..|..:       :||.|  :|...||||..:|               
  Fly   212 WNANC-----TISGAAAQTAAAS-------SLHQA--SNHTFYPWMAIAGECPEDPTKSKIRSDL 262

Human   128 -----------------------PD-------RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIE 162
                                   ||       |:|||||||||||||||||||.|.|||||||||
  Fly   263 TQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIE 327

Human   163 IAHALCLTERQIKIWFQNRRMKWKKE-----HKDEGPTAAAAPEGAVPSAAATA 211
            :|||||||||||||||||||||.|||     ..:|....|.|.:.|..:|||.|
  Fly   328 MAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAAAAAAA 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA7NP_008827.2 Antp-type hexapeptide 119..124 3/4 (75%)
Homeobox 134..186 CDD:278475 48/51 (94%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..230 10/30 (33%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 48/52 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.