DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA7 and Antp

DIOPT Version :10

Sequence 1:NP_008827.2 Gene:HOXA7 / 3204 HGNCID:5108 Length:230 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:78 Identity:67/78 - (85%)
Similarity:71/78 - (91%) Gaps:3/78 - (3%)


- Green bases have known domain annotations that are detailed below.


Human   119 IYPWMRS---SGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQN 180
            :||||||   ...:|||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   283 LYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQN 347

Human   181 RRMKWKKEHKDEG 193
            ||||||||:|.:|
  Fly   348 RRMKWKKENKTKG 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA7NP_008827.2 Antp-type hexapeptide 119..124 3/4 (75%)
Homeodomain 131..187 CDD:459649 55/55 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..230 4/7 (57%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 14/22 (64%)
Homeodomain 298..354 CDD:459649 55/55 (100%)

Return to query results.
Submit another query.