DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA7 and ftz

DIOPT Version :9

Sequence 1:NP_008827.2 Gene:HOXA7 / 3204 HGNCID:5108 Length:230 Species:Homo sapiens
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:231 Identity:88/231 - (38%)
Similarity:115/231 - (49%) Gaps:53/231 - (22%)


- Green bases have known domain annotations that are detailed below.


Human     9 ALFSKYTAGASLFQNAE----PTSCS---------FAPNSQ----RSG-YGAGAGAFASTVPGLY 55
            |:.:|.||..:...:.|    ||..:         ::|.||    ::| :........:::|.|.
  Fly   139 AVSTKVTASPAPSYDQEYVTVPTPSASEDVDYLDVYSPQSQTQKLKNGDFATPPPTTPTSLPPLE 203

Human    56 NVNSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGAAEANF-RI 119
            .:::| .|||            |....::..|.|            :.....|.:||.:.|: .|
  Fly   204 GISTP-PQSP------------GEKSSSAVSQEI------------NHRIVTAPNGAGDFNWSHI 243

Human   120 YPWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMK 184
            ...:.|...|.||.|||||||||||||||||||||:||||||:||:||.|:||||||||||||||
  Fly   244 EETLASDCKDSKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMK 308

Human   185 WKK--------EHKDEGPTAAAAPEGAVPSAAATAA 212
            .||        ||...|.||...|..|. |.|.|.|
  Fly   309 SKKDRTLDSSPEHCGAGYTAMLPPLEAT-STATTGA 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA7NP_008827.2 Antp-type hexapeptide 119..124 1/4 (25%)
Homeobox 134..186 CDD:278475 46/51 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..230 12/34 (35%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 25/133 (19%)
Homeobox 257..310 CDD:278475 46/52 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.