DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA7 and zen2

DIOPT Version :9

Sequence 1:NP_008827.2 Gene:HOXA7 / 3204 HGNCID:5108 Length:230 Species:Homo sapiens
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:116 Identity:46/116 - (39%)
Similarity:66/116 - (56%) Gaps:7/116 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   109 LHGAAEANFRIYPWMRSSGPDR-KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTER 172
            ::...|.|....|...:...:: ||.|..::..|.:|||:|||.|:||.|.|||||:..|.||||
  Fly    21 MYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTER 85

Human   173 QIKIWFQNRRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDE 223
            |:||||||||||.||....:|..      ||:.::...::....|.:.||:
  Fly    86 QVKIWFQNRRMKLKKSTNRKGAI------GALTTSIPLSSQSSEDLQKDDQ 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA7NP_008827.2 Antp-type hexapeptide 119..124 1/4 (25%)
Homeobox 134..186 CDD:278475 33/51 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..230 7/37 (19%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.