DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA7 and unpg

DIOPT Version :9

Sequence 1:NP_008827.2 Gene:HOXA7 / 3204 HGNCID:5108 Length:230 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:174 Identity:55/174 - (31%)
Similarity:76/174 - (43%) Gaps:46/174 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    52 PGLYNVNSP----LYQSPFASG--------YGLGADAYGNLPCASYDQNIPGLCSDLA------- 97
            ||:..:..|    .:.||..||        ..:|.|.  :..|:.      ..|||::       
  Fly   211 PGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDE--DFECSG------DSCSDISLTMSPRN 267

Human    98 -KGACDKT---------------DEGA--LHGAAEANFRIYPWMRSSGPDRKRGRQT-YTRYQTL 143
             .|..||:               ||||  .|.......:......||...:.|.|:| :|..|.|
  Fly   268 YNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLL 332

Human   144 ELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 187
            |||:|||..:||:...|.:||.:|.|:|.|:||||||||.|||:
  Fly   333 ELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA7NP_008827.2 Antp-type hexapeptide 119..124 0/4 (0%)
Homeobox 134..186 CDD:278475 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..230 0/1 (0%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/50 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.