DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sev and Ret

DIOPT Version :9

Sequence 1:NP_511114.2 Gene:sev / 32039 FlyBaseID:FBgn0003366 Length:2554 Species:Drosophila melanogaster
Sequence 2:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster


Alignment Length:427 Identity:136/427 - (31%)
Similarity:209/427 - (48%) Gaps:96/427 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  2105 PYSEESERVAEPFVSPEKRGS---------LVLAIIAPAA---------IVSSCVLALVLV---- 2147
            |...::|..|||.:. .:||:         ::|.::..|.         .|.:|.|..||:    
  Fly   650 PRKRKNETEAEPLLG-VRRGTPPNQPLQDPMLLGVLNVAGFECDRSCMFFVITCPLLFVLLLLCL 713

  Fly  2148 ----RKVQKRRLRAKKLLQQSRPSIWSNLSTLQTQQQLMAVRNRAFSTTLSDADIALLP------ 2202
                ||:.:|||..:.:...|:.::..:                      ...|.||:|      
  Fly   714 LIAQRKMLQRRLGKQSMTTSSKQALPES----------------------GGGDFALMPLQSGFR 756

  Fly  2203 ----QINW----SQLKLLRFLGSGAFGEVYEGQLKTEDSEEP--QRVAIKSLRKGAS--EFAELL 2255
                ...|    .:|:|...||.|.||:|.:| ..||.:..|  ..||:|.|:||::  |:..||
  Fly   757 FESGDAKWEFPREKLQLDTVLGEGEFGQVLKG-FATEIAGLPGITTVAVKMLKKGSNSVEYMALL 820

  Fly  2256 QEAQLMSNFKHENIVCLVGICFDTESISLIMEHMEAGDLLSYLRAARATSTQEPQPTAGLSLSE- 2319
            .|.||:....|.|::.|:|.|..:|:..||:|:...|.|.||||.:|...      .||:..:: 
  Fly   821 SEFQLLQEVSHPNVIKLLGACTSSEAPLLIIEYARYGSLRSYLRLSRKIE------CAGVDFADG 879

  Fly  2320 --------LLAMCIDVANGCSYLEDMHFVHRDLACRNCLVTESTGSTDRRRTVKIGDFGLARDIY 2376
                    :|.....:..|.:||.::..||||||.||.|:.:.       :..||.||||.||:|
  Fly   880 VEPVNVKMVLTFAWQICKGMAYLSELKLVHRDLAARNVLLADG-------KICKISDFGLTRDVY 937

  Fly  2377 KSDYYRKEGEGLLPVRWMSPESLVDGLFTTQSDVWAFGVLCWEILTLGQQPY---AARNNFEVLA 2438
            :.|.|.|.....:||:||:||||.|.::|::||||:|||||||::|||..||   |.:|.:.:| 
  Fly   938 EDDAYLKRSRDRVPVKWMAPESLADHVYTSKSDVWSFGVLCWELITLGASPYPGIAPQNLWSLL- 1001

  Fly  2439 HVKEGGRLQQPPMCTEKLYSLLLLCWRTDPWERPSFR 2475
              |.|.|:.:|..|:|.:||::..||..:|..||||:
  Fly  1002 --KTGYRMDRPENCSEAVYSIVRTCWADEPNGRPSFK 1036

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sevNP_511114.2 fn3 439..520 CDD:278470
FN3 826..921 CDD:238020
LY 993..1026 CDD:214531
FN3 1292..1374 CDD:214495
FN3 1799..1897 CDD:238020
FN3 1993..2111 CDD:238020 1/5 (20%)
Pkinase_Tyr 2209..2481 CDD:285015 111/283 (39%)
PTKc_c-ros 2213..2483 CDD:270640 109/279 (39%)
RetNP_477044.1 PKc_like 770..1049 CDD:304357 111/284 (39%)
TyrKc 771..1042 CDD:197581 111/283 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455269
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.