DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sev and Cad96Ca

DIOPT Version :9

Sequence 1:NP_511114.2 Gene:sev / 32039 FlyBaseID:FBgn0003366 Length:2554 Species:Drosophila melanogaster
Sequence 2:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster


Alignment Length:483 Identity:139/483 - (28%)
Similarity:214/483 - (44%) Gaps:112/483 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  2122 KRGSLVLAIIAPAAIVSSCVLALVLVR-----------KVQKRRLRAKK---------LLQQSR- 2165
            |.|::.:.:......|:..||...|.|           |.:::...|||         |...|| 
  Fly   312 KSGTIPIVVTVGGFFVAIAVLLAYLCRRRLCAISRTLKKTKEKEELAKKSNQSQLSSTLTDDSRN 376

  Fly  2166 ---------PSIWSNLSTLQTQQQLMAVRNRAFSTTLSDADI----------------------- 2198
                     |..::|......:.|.|.:.....||.:::..:                       
  Fly   377 SMVMQQWQGPVAFANRYVPWERDQQMGIATSQLSTGVTNGGVSSPGVPSPGTGEPGSNLGPGCLT 441

  Fly  2199 -----------ALLPQIN---WS----QLKLLRFLGSGAFGEVYEGQLKTEDSEEP-QRVAIKSL 2244
                       |...:.|   |.    :||....||.||||:|:..:....:..|. ..||:|:|
  Fly   442 GGAGSSGAPENAFAGEANCDRWEFPRYRLKFFNILGEGAFGQVWRCEATNINGNEGITTVAVKTL 506

  Fly  2245 RKGASEF--AELLQEAQLMSNFK-HENIVCLVGICFDTESISLIMEHMEAGDLLSYLRAARATST 2306
            ::.|:|.  .:||.|.::|.:.: |.|:|.|:|.|.|.:...:|:|::..|.|.:|||::||  .
  Fly   507 KESATEVDRKDLLSELEVMKSLEPHINVVHLLGCCTDKDPTFVILEYVNRGKLQTYLRSSRA--E 569

  Fly  2307 QEPQPTAG----LSLSELLAMCIDVANGCSYLEDMHFVHRDLACRNCLVTESTGSTDRRRTVKIG 2367
            :....|.|    |:..:|.:....||.|..||.....:|||||.||.|:|:.       .|.|:.
  Fly   570 RHYGNTHGKSNVLTSCDLTSFMYQVAKGMDYLTSRGIIHRDLAARNILITDD-------HTCKVA 627

  Fly  2368 DFGLARDIYKSDYYRKEGEGLLPVRWMSPESLVDGLFTTQSDVWAFGVLCWEILTLGQQPYAARN 2432
            |||.|||:..|..|.::.||.||:|||:.|||.|.:|:.:||:|:||:|.|||:|||..||...:
  Fly   628 DFGFARDVITSKIYERKSEGKLPIRWMATESLYDNIFSVKSDIWSFGILMWEIVTLGSTPYPGIS 692

  Fly  2433 NFEVLAHVKEGGRLQQPPMCTEKLYSLLLLCWRTDPWERPSFRRCYNTLHAISTDLRRTQMASAT 2497
            ..:|:..|::|.||::|..|..:||:::..||..||.|||.|......|    ..|..|:|    
  Fly   693 AADVMRKVRDGYRLEKPEHCRRELYNIMYYCWSHDPQERPLFAEIIQML----DKLLHTEM---- 749

  Fly  2498 ADTVVSCSRPEFKVRFDGQPLEEHREHN 2525
                            |...||...:||
  Fly   750 ----------------DYIELERFPDHN 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sevNP_511114.2 fn3 439..520 CDD:278470
FN3 826..921 CDD:238020
LY 993..1026 CDD:214531
FN3 1292..1374 CDD:214495
FN3 1799..1897 CDD:238020
FN3 1993..2111 CDD:238020
Pkinase_Tyr 2209..2481 CDD:285015 107/279 (38%)
PTKc_c-ros 2213..2483 CDD:270640 106/277 (38%)
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 107/279 (38%)
PTKc 474..742 CDD:270623 106/280 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455276
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.