DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sev and MET

DIOPT Version :9

Sequence 1:NP_511114.2 Gene:sev / 32039 FlyBaseID:FBgn0003366 Length:2554 Species:Drosophila melanogaster
Sequence 2:XP_011514525.1 Gene:MET / 4233 HGNCID:7029 Length:1409 Species:Homo sapiens


Alignment Length:530 Identity:156/530 - (29%)
Similarity:235/530 - (44%) Gaps:113/530 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  2060 EPVVVEDQWLDFCNTTELSCIVKSLHSSRLL------LFRVRARSLEHGWGPYSEESERVAEPFV 2118
            :|..|:.:.|...|.   ||....|||..:|      |.::.: .|...| ..:..|..:.:..|
Human   885 DPEAVKGEVLKVGNK---SCENIHLHSEAVLCTVPNDLLKLNS-ELNIEW-KQAISSTVLGKVIV 944

  Fly  2119 SPEKRGSLVLAIIAPAAIVSSCVLALV-----LVRKVQKRRLRAKKLLQQSR------------- 2165
            .|::.   ...:||....:|:.:|.|:     |.::.|.:.|.::.:...:|             
Human   945 QPDQN---FTGLIAGVVSISTALLLLLGFFLWLKKRKQIKDLGSELVRYDARVHTPHLDRLVSAR 1006

  Fly  2166 -------------------------PSIWSNLSTLQTQQQLMAVRNRAFSTTLSDADI------- 2198
                                     |:...|.|..|.|..|   .:.:...|..|:||       
Human  1007 SVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPL---TDMSPILTSGDSDISSPLLQN 1068

  Fly  2199 -------ALLPQ---------INWSQLKLLRF---LGSGAFGEVYEGQLKTEDSEEPQRVAIKSL 2244
                   ||.|:         |..|.| ::.|   :|.|.||.||.|.|...|.:: ...|:|||
Human  1069 TVHIDLSALNPELVQAVQHVVIGPSSL-IVHFNEVIGRGHFGCVYHGTLLDNDGKK-IHCAVKSL 1131

  Fly  2245 RK--GASEFAELLQEAQLMSNFKHENIVCLVGICFDTESISL-IMEHMEAGDLLSYLRAARATST 2306
            .:  ...|.::.|.|..:|.:|.|.|::.|:|||..:|...| ::.:|:.|||.:::|    ..|
Human  1132 NRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIR----NET 1192

  Fly  2307 QEPQPTAGLSLSELLAMCIDVANGCSYLEDMHFVHRDLACRNCLVTESTGSTDRRRTVKIGDFGL 2371
            ..|      ::.:|:...:.||.|..||....|||||||.|||::       |.:.|||:.||||
Human  1193 HNP------TVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCML-------DEKFTVKVADFGL 1244

  Fly  2372 ARDIYKSDYY---RKEGEGLLPVRWMSPESLVDGLFTTQSDVWAFGVLCWEILTLGQQPYAARNN 2433
            |||:|..:||   .|.| ..|||:||:.|||....|||:||||:||||.||::|.|..||...|.
Human  1245 ARDMYDKEYYSVHNKTG-AKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNT 1308

  Fly  2434 FEVLAHVKEGGRLQQPPMCTEKLYSLLLLCWRTDPWERPSFRRCYNTLHAISTDLRRTQMASATA 2498
            |::..::.:|.||.||..|.:.||.::|.||......||||....:.:.||.:...........|
Human  1309 FDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNA 1373

  Fly  2499 DTV-VSCSRP 2507
            ..| |.|..|
Human  1374 TYVNVKCVAP 1383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sevNP_511114.2 fn3 439..520 CDD:278470
FN3 826..921 CDD:238020
LY 993..1026 CDD:214531
FN3 1292..1374 CDD:214495
FN3 1799..1897 CDD:238020
FN3 1993..2111 CDD:238020 13/56 (23%)
Pkinase_Tyr 2209..2481 CDD:285015 109/280 (39%)
PTKc_c-ros 2213..2483 CDD:270640 108/278 (39%)
METXP_011514525.1 Sema_MET 44..535 CDD:200539
PSI 538..580 CDD:214655
IPT_plexin_repeat1 582..675 CDD:238585
IPT_plexin_repeat2 676..759 CDD:238584
IPT_plexin_repeat3 761..856 CDD:238586
IPT 857..953 CDD:214657 16/75 (21%)
Pkinase_Tyr 1097..1356 CDD:285015 108/277 (39%)
PTKc_Met_Ron 1101..1362 CDD:270649 109/279 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1095
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.