DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sev and Tie

DIOPT Version :9

Sequence 1:NP_511114.2 Gene:sev / 32039 FlyBaseID:FBgn0003366 Length:2554 Species:Drosophila melanogaster
Sequence 2:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster


Alignment Length:340 Identity:107/340 - (31%)
Similarity:154/340 - (45%) Gaps:82/340 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  2207 SQLKLLRFLGSGAFGEVYEGQLKTEDSE----EPQRVAIKSLRKGASEFAELLQEAQLMSNF-KH 2266
            |.::|...||.|.||:|::.:  .:|..    ..:.||:|::| ..|....|..||.:|... .|
  Fly   852 SNIRLKSLLGEGNFGQVWKAE--ADDLSGHFGATRIVAVKTIR-ACSAQVSLKDEANIMRKLGSH 913

  Fly  2267 ENIVCLVGICFDTESISLIMEHMEAGDLLSYLRAARATSTQEPQPTAG------LSLSELLAMCI 2325
            :|:|.|:|.|.::|...||||:...|.|||.|||||:.:...|....|      ||...|....:
  Fly   914 QNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLAPLSPRTLAGFAL 978

  Fly  2326 DVANGCSYLEDMHFVHRDLACRNCLVTESTGSTDRRRTVKIGDFGLARDI--------------- 2375
            |:|.|..|:.....||||||.||.|:       |.....||.|||::.|:               
  Fly   979 DIACGMEYIAGRRIVHRDLAARNVLL-------DHNGMCKICDFGMSIDLDAERMRKEQEKNAAN 1036

  Fly  2376 ---------YKSDYYRK-------------EGEG------------------------LLPVRWM 2394
                     :|.|:..:             :|:|                        .||:|||
  Fly  1037 DLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPIRWM 1101

  Fly  2395 SPESLVDGLFTTQSDVWAFGVLCWEILTLGQQPYAARNNFEVLAHVKEGGRLQQPPMCTEKLYSL 2459
            :||||...:|||::|:||||::.|||.|||..||:.....||:..|.:|.|...|.....:.|:|
  Fly  1102 APESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKESRHEFYNL 1166

  Fly  2460 LLLCWRTDPWERPSF 2474
            :..||..:|..||||
  Fly  1167 MSRCWHKEPHMRPSF 1181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sevNP_511114.2 fn3 439..520 CDD:278470
FN3 826..921 CDD:238020
LY 993..1026 CDD:214531
FN3 1292..1374 CDD:214495
FN3 1799..1897 CDD:238020
FN3 1993..2111 CDD:238020
Pkinase_Tyr 2209..2481 CDD:285015 106/338 (31%)
PTKc_c-ros 2213..2483 CDD:270640 105/334 (31%)
TieNP_523928.1 TyrKc 854..1183 CDD:197581 106/338 (31%)
PTKc 860..1187 CDD:270623 105/332 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.