DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sev and C25A8.5

DIOPT Version :10

Sequence 1:NP_511114.2 Gene:sev / 32039 FlyBaseID:FBgn0003366 Length:2554 Species:Drosophila melanogaster
Sequence 2:NP_501081.1 Gene:C25A8.5 / 182879 WormBaseID:WBGene00016085 Length:416 Species:Caenorhabditis elegans


Alignment Length:32 Identity:8/32 - (25%)
Similarity:15/32 - (46%) Gaps:0/32 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 FIGIFFPKTILGYLPIPPFLESTIIHISLTLY 99
            |..:.:|.....:||.|..|.:.:..:.:|.|
 Worm   308 FYTVLYPWLSKSWLPQPLVLPAEVYKVGVTHY 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sevNP_511114.2 fn3 439..520 CDD:394996
FN3 826..921 CDD:238020
Vgb 992..>1118 CDD:443399
LY 993..1026 CDD:214531
FN3 1292..1374 CDD:214495
fn3 1800..1891 CDD:394996
FN3 1993..2111 CDD:238020
PTKc_c-ros 2213..2483 CDD:270640
C25A8.5NP_501081.1 SH2_Fps_family 4..98 CDD:198224
PTKc 124..375 CDD:270623 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.