DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sev and F11E6.8

DIOPT Version :9

Sequence 1:NP_511114.2 Gene:sev / 32039 FlyBaseID:FBgn0003366 Length:2554 Species:Drosophila melanogaster
Sequence 2:NP_001255960.1 Gene:F11E6.8 / 178530 WormBaseID:WBGene00008711 Length:442 Species:Caenorhabditis elegans


Alignment Length:447 Identity:136/447 - (30%)
Similarity:213/447 - (47%) Gaps:85/447 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  2065 EDQWLDFCN--TTELSCIVKSLHSSRLLLFRVRARSLEHGWGPYSEESERVAEPFVSPEKRGSLV 2127
            |.:|| |..  ||..|.|:|:..::.:.|..:...||                         :|:
 Worm    14 ELEWL-FPKEVTTSSSAILKNKSAAEIPLNFLAEHSL-------------------------ALI 52

  Fly  2128 LAIIAPAAIVSSCVLALVLVRKVQKRR----LRAKKLLQQS---RPSIWSNLSTLQTQQQLMAVR 2185
            .|:.  ..:::..:||:::....||..    |.|..:..:|   .||.|:..||:.:.....::.
 Worm    53 AALF--LVVLTVALLAVLVQYHCQKGTNSGGLGAGAISPKSFSTSPSQWTTCSTVSSTYSTQSLL 115

  Fly  2186 NRAFSTTLSDADIALLPQINWSQLKLLRFLGSGAFGEVYEGQLKTEDSEEPQ----RVAIKSLR- 2245
            ....|.........|||.   ..:.|...:|.|.||.||.|:::     :|.    .||:|:|: 
 Worm   116 QLIGSDLRQSLQGLLLPS---EAVVLETIVGKGYFGNVYRGRMR-----DPAGRLIPVAVKTLKG 172

  Fly  2246 ---KGASEFAELLQEAQLMSNFKHENIVCLVGICFDTESIS------LIMEHMEAGDLLSYLRAA 2301
               :..:...:.|:|..:|.:..|.:::.|:||     |||      :::.:||.|||.:|:   
 Worm   173 ERARDIAHIEKFLREGVVMKHLDHPHVLSLLGI-----SISPAGNPWVVLPYMEGGDLKTYI--- 229

  Fly  2302 RATSTQEPQPTAGLSLSELLAMCIDVANGCSYLEDMHFVHRDLACRNCLVTESTGSTDRRRTVKI 2366
                   ..|...|.:.|||.....||.|.|||...||||||||.|||::     |.|  |.||:
 Worm   230 -------ADPNRALCVLELLDFAHQVAQGMSYLAAQHFVHRDLAARNCMI-----SAD--RIVKV 280

  Fly  2367 GDFGLARDIYKSDYYRKE---GEGLLPVRWMSPESLVD-GLFTTQSDVWAFGVLCWEILTLGQQP 2427
            .|||||.|:...:.|..|   |...||::|::||||.| .:|::.:|||:||||.||:||....|
 Worm   281 ADFGLAVDLLDKESYIDESETGPARLPLKWLAPESLRDRRVFSSATDVWSFGVLMWELLTRAASP 345

  Fly  2428 YAARNNFEVLAHVKEGGRLQQPPMCTEKLYSLLLLCWRTDPWERPSFRRCYNTLHAI 2484
            |...:|.:|..:::.|.||.||..|.:.:|.|:..|||:.|.:||.|....:.|.|:
 Worm   346 YGEVSNTKVRHYLETGMRLPQPTHCPDIIYDLMQCCWRSTPEDRPDFVFLSHRLRAL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sevNP_511114.2 fn3 439..520 CDD:278470
FN3 826..921 CDD:238020
LY 993..1026 CDD:214531
FN3 1292..1374 CDD:214495
FN3 1799..1897 CDD:238020
FN3 1993..2111 CDD:238020 12/47 (26%)
Pkinase_Tyr 2209..2481 CDD:285015 104/289 (36%)
PTKc_c-ros 2213..2483 CDD:270640 104/287 (36%)
F11E6.8NP_001255960.1 PTKc 141..400 CDD:270623 103/285 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.