DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15203 and CG34215

DIOPT Version :9

Sequence 1:NP_001285105.1 Gene:CG15203 / 32038 FlyBaseID:FBgn0030261 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001097204.1 Gene:CG34215 / 5740170 FlyBaseID:FBgn0085244 Length:104 Species:Drosophila melanogaster


Alignment Length:97 Identity:30/97 - (30%)
Similarity:48/97 - (49%) Gaps:13/97 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVIAGALLFSMLSQVSGYSGRIP----PDADNPGKCMYRGDVLELGVNNGIAP--CQRLTCNKDG 73
            |:.|.|:|.     ||||...:.    .|..:||||:..|.|||.| .:...|  |:|:.|.::.
  Fly     7 LLAAIAVLL-----VSGYEAAVVRGVFEDPTHPGKCVLEGLVLEKG-QSARHPQRCERIICGENS 65

  Fly    74 SILIEGCGKLRIENCNR-GERISPGEPFPECC 104
            :..|:.||...:....: |:..:|...:|:||
  Fly    66 AAEIQSCGAYGLPPGKKFGKYTNPNADYPDCC 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15203NP_001285105.1 SVWC 46..110 CDD:292070 18/62 (29%)
CG34215NP_001097204.1 SVWC 37..99 CDD:292070 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.