DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15203 and CG2444

DIOPT Version :10

Sequence 1:NP_572679.1 Gene:CG15203 / 32038 FlyBaseID:FBgn0030261 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_572739.1 Gene:CG2444 / 32121 FlyBaseID:FBgn0030326 Length:114 Species:Drosophila melanogaster


Alignment Length:104 Identity:25/104 - (24%)
Similarity:48/104 - (46%) Gaps:10/104 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IAGALLFSMLSQVSGYSGRIP------PDADNPGKCMYRGDVLELGVNNGIA---PCQRLTCNKD 72
            :|..||..::..:.|:.|:..      .::.:||||:...:.:......|:|   ||.|..|:.|
  Fly     7 VAAFLLLGLVVILGGHVGQAAVAKVKLNNSSHPGKCVLDTNTILSPGETGLAPDLPCVRAECHAD 71

  Fly    73 GSILIEGCGKLR-IENCNRGERISPGEPFPECCKLRYKC 110
            |.:..:.|..:. ...|.:.:.::....||.||:.:|.|
  Fly    72 GLVTFKTCDAVAPPPGCKQRDFVNINREFPACCERKYNC 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15203NP_572679.1 SVWC <63..110 CDD:464713 13/47 (28%)
CG2444NP_572739.1 SVWC 42..110 CDD:464713 16/67 (24%)

Return to query results.
Submit another query.