DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15203 and msmb.3

DIOPT Version :9

Sequence 1:NP_001285105.1 Gene:CG15203 / 32038 FlyBaseID:FBgn0030261 Length:128 Species:Drosophila melanogaster
Sequence 2:XP_002936006.1 Gene:msmb.3 / 100125220 XenbaseID:XB-GENE-1018396 Length:111 Species:Xenopus tropicalis


Alignment Length:83 Identity:26/83 - (31%)
Similarity:37/83 - (44%) Gaps:7/83 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NPLIPLVIAGALLFSMLSQVSGYSGRIPPDADNPGKCMYRGDVLELGVNNGIAPCQRLTCNKDGS 74
            |.|:..|||..||   ::....|....||:......|:|:|.:.|||.......|...:|:.|||
 Frog     2 NFLLACVIAVGLL---VTACHAYCNFYPPELGEAKGCLYKGKLHELGSKFRTKDCMDCSCDMDGS 63

  Fly    75 I-LIEGCG---KLRIENC 88
            : ..:|.|   ....|||
 Frog    64 MECCQGYGTPVAYDKENC 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15203NP_001285105.1 SVWC 46..110 CDD:292070 16/47 (34%)
msmb.3XP_002936006.1 PSP94 <38..106 CDD:283482 14/44 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.