DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1537 and CG1545

DIOPT Version :9

Sequence 1:NP_572678.1 Gene:CG1537 / 32037 FlyBaseID:FBgn0030260 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_572677.2 Gene:CG1545 / 32036 FlyBaseID:FBgn0030259 Length:128 Species:Drosophila melanogaster


Alignment Length:85 Identity:30/85 - (35%)
Similarity:50/85 - (58%) Gaps:12/85 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DFHHHGGSHHIRRNINHCWRRYDGYNLQNTVVNKKEQLKKPYGILCNFKCTWFFTVSFPTCEFIY 108
            |::|  ||.     .:.||::::..::|    ....:.|:|:||||.::|..:|...:|.||||:
  Fly    43 DYNH--GSW-----ASQCWKKHNSGSIQ----TPDGEFKRPFGILCTYRCFLWFPPIYPYCEFIF 96

  Fly   109 DYKLSCVLFTSLPDCTSVQC 128
            |.:|| ..|||.|||..::|
  Fly    97 DLRLS-RHFTSFPDCYEIRC 115



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458923
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCZH
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019765
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.